SecReT6
Protein ID: 291281038
SecReT6 ID383
T6SS typei1
Gene symbolimpA
Locus tagG2583_0226
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]243937..245436 [-]
ProductImpA domain protein
NoteTssA
UniProt IDD3QWL6
KEGG IDeok:G2583_0226
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.20E-44, Aligned region: 322..466
ImpA-rel_N [PF06812], Evalue: 6.90E-21, Aligned region: 71..130
Protein Sequence: 499 a.a.     [Download]
>gi|291281038|ref|YP_003497856.1| ImpA domain protein [Escherichia coli O55:H7 str. CB9615]
MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPEL
NWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLD
WFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACS
VAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADS
RWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGL
GQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVLNG
EFNLFNTKW
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c245436-243937 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
GTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACAC
ACTGTACTGAGGAGGCAGGGATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCG
CGGGCTGCCGGAATTCAGCGCCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTG
AACTGGAAACTGGTGGAGTCGCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCA
CCTACTATACGCTTGCCCGGACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGC
GGCAATGGTAAGCCACGACTGGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGAC
TGGTTTAACTCCCGAACCGGCAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGA
TCTACCGCACAGAGCGGGCATTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCC
GCGCGTGGAGAATCTGCTCTATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAAC
ACTGAGAACGCCGCACAGACCACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACAC
CAGAAGCGGTAGTGCCTCCCCTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAA
TCCCCCACAGGCCAGTGTGATAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCA
GTGGCTGTCGCCTCAGCATTGTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACG
ACACCGCTCAGGGCGCAGCAACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCA
ACAACTTCTTGATACCTCCCCGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGT
CGCTGGCCGGAAAGCCTGCAACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCAC
AGAGTAGCCCGCAGTTGCGTGGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGAT
GCAGCGCGAGAAAGAGGGACTAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTG
GGGCAGGAAACACCCGTTGAGTCTCTGTTGACGCAGTACCAGGATGCCCGTGCGCAGAAGCAGAATACAG
ATGCGCTGGAAAAACAAATTAATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAA
TACGATACCGACGATAAAAAAAGCATTGAATTTCAATAACATTCATGAATACAAAGGAGTTTTAAATGGC
GAATTTAATTTATTTAACACTAAATGGTGA