SecReT6
Protein ID: 291281040
SecReT6 ID383
T6SS typei1
Gene symbolimpA
Locus tagG2583_0228
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]248900..250312 [-]
ProductImpA domain protein
NoteTssA
UniProt IDD3QWL8
KEGG IDeok:G2583_0228
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 152..183
Protein Sequence: 470 a.a.     [Download]
>gi|291281040|ref|YP_003497858.1| ImpA domain protein [Escherichia coli O55:H7 str. CB9615]
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKLGSLAHAQLDIPELQRRGLQLLASES
KDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYWTVAAPQNMAHKKRFASQIIKRFETGIEGFSQNAATT
QRDTLLGELAKLAQCWQSHNVPELAQATDDLFALYQRTFNRAAPAPVPTPAASGSSPQTTVTSESGVTQP
SAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSAD
MVADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQLTGL
LFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c250312-248900 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAAAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGGACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGGTC
TCTGGCCCACGCTCAGCTTGATATTCCCGAACTACAACGCAGGGGGCTACAGCTTCTGGCTTCTGAAAGC
AAAGACTTCAGGCTACTGGCACACCTGCTCAGAACCCTGCAACATGCCGGTGATCCACTGCTGGCACTGC
ACCTGCTAACGCTATACGTGGAACATTACTGGACTGTGGCCGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGATCATTAAACGTTTTGAAACGGGTATTGAAGGCTTTTCACAAAACGCTGCCACAACG
CAGCGCGATACTCTGCTGGGTGAGCTGGCGAAACTGGCGCAGTGCTGGCAGTCACATAACGTCCCGGAAC
TGGCACAGGCTACCGATGATCTTTTTGCCCTGTACCAGCGTACGTTTAATCGTGCGGCTCCTGCTCCGGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAAACCACCGTCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGCCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCTATTTTATGTGAACGCCAGCCGGACTCGCCGCAGGGCTATCGCCTGCGCCGCCATGCCCTGTG
GCAATCCATCACCAGTACACCCCAGGCGGAAAGCGATGGACGTACCCCACTGGCTGCGGTCTCTGCCGAT
ATGGTGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGCGCTGTGGCAACAGGTTGAGAAAAGCG
TATTGCTGGCTCCTTACTGGCTGGACGGTCACTGTCTTTCTGCACAGACGGCACTGCGTCTGGGTTACAA
ACAGGTGGCAGACACCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCGCACACCGTTTCTCAGTGAGCAGACGAAACAATGGCTGGCTGCTTCGCCCGACGGCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGCAGGCAGCCAGAGCCTGTTTTGCTGGGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAGGAGGCGGGGCTGATACAGCTTGCGCAGCAACAGTACCGGATGTTGTTGA
TGATAGGGAGTCAGATGATGGTGTCTGACTGGGAGCCATCATTACTTACGCAGCTTGAACAAAAATTCAC
GGCAGAACAATAA