SecReT6
Protein ID: 291281042
SecReT6 ID383
T6SS typei1
Gene symbolclpB
Locus tagG2583_0230
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]251057..253840 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD3QWM0
KEGG IDeok:G2583_0230
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.60E-39, Aligned region: 224..242
AAA_2 [PF07724], Evalue: 9.60E-39, Aligned region: 650..811
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 656..773
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 784..847
AAA_5 [PF07728], Evalue: 7.10E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.10E-14, Aligned region: 655..775
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 817..893
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 626..696
AAA_16 [PF13191], Evalue: 4.10E-11, Aligned region: 721..749
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 654..689
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 650..684
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 782..847
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 6.60E-05, Aligned region: 653..680
AAA_14 [PF13173], Evalue: 9.20E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.20E-05, Aligned region: 655..745
NACHT [PF05729], Evalue: 9.40E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 9.40E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 9.40E-05, Aligned region: 656..684
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 649..677
DUF258 [PF03193], Evalue: 0.00027, Aligned region: 191..239
DUF258 [PF03193], Evalue: 0.00027, Aligned region: 656..674
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 656..690
AAA_17 [PF13207], Evalue: 0.0093, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0093, Aligned region: 656..690
IstB_IS21 [PF01695], Evalue: 0.0094, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0094, Aligned region: 655..666
Protein Sequence: 927 a.a.     [Download]
>gi|291281042|ref|YP_003497860.1| type VI secretion ATPase, ClpV1 family [Escherichia coli O55:H7 str. CB9615]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDASDTLLARYAKNMTEDARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESESESEQDNTGAVPADETDREQPEETAETVSP
VQRLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLA
IASLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRL
IGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFL
TSNLGYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSR
FGAEVVIEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTAD
VEDAQNDESVTKDETVL
 
Nucleotide Sequence: 2784 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c253840-251057 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCAGAATGTATGAGCCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
TTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTTAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCTTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACACTGACGGACGCCTCTGACACCCTGCTTGCCCGCTACGCCAAAAACAT
GACAGAAGACGCCCGTAACGGCAGGCTAGACCCAGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAACTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCATCGGTGAAGGGTGAGTTTGAAAAACGCTTCAAGGGG
CTGATGGCGGAGGTCATTTCCTCTCCGGTGCCGGTCATTCTGTTTATCGACGAAGCGCATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTGAAACCGGCGCTGGCGCGTGGCGAACT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAGAAAGACGCCGCCCTGTCGCGC
CGCTTCCAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACAATTATTCTGCGTGGTCTGTCGG
CGGTCTATGAACGGTCTCACGGCGTGCTGATTGACGATGATGCCTTGCAGGCCGCAGCAACGCTGAGCGA
ACGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCTTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACTGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAGTCAGAGTCAGAACAGGATAA
TACCGGTGCCGTACCGGCTGATGAGACCGACAGAGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCG
GTACAGCGGCTGGCCCAGCTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTCTCCCCGC
ACGTCGATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTCAACCGCCTGTCGCA
GAATGAAATGTCGGTCATCACCGACCTGCCGAAATGGCTGGGCGACACCATCAAAGGCCAGGACCTGGCG
ATTGCCAGCCTGCATAAGCATCTACTGACCGCACGCGCCGACCTGCGTCGTCCGGGACGCCCGCTCGGTG
CGTTCCTGCTCGCTGGCCCCAGCGGCGTGGGTAAAACCGAAACCGTCCTGCAACTGGCAGAGCTGCTCTA
CGGCGGTCGCCAGTACCTGACCACCATCAATATGTCCGAGTTCCAGGAGAAACACACCGTTTCGCGGCTG
ATTGGCTCCCCTCCGGGCTATGTCGGCTATGGCGAAGGCGGCGTGCTGACTGAAGCCATCCGCCAGAAAC
CCTACTCGGTGGTGCTGCTCGATGAAGTGGAAAAAGCGCACCCGGATGTCCTCAACCTGTTCTACCAGGC
GTTTGACAAGGGCGAGATGGCCGACGGCGAAGGCCGCCTGATTGACTGTAAAAACATCGTCTTCTTCCTC
ACCTCCAACCTCGGTTACCAGGTGATTGTCGAACACGCGGATGACCCGGAAACCATGCAGGAAGCCCTCT
ATCCGGTGCTGGCGGACTTCTTTAAACCTGCCCTGCTGGCGCGAATGGAGGTGGTGCCGTACCTGCCGCT
GTCGAAAGAGACGCTCGCCACCATTATCGCCGGGAAACTGGCCCGTCTGGATAACGTGCTGCGCAGTCGC
TTTGGTGCAGAAGTGGTCATTGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAA
ACGGCGCGAGGATGCTGGAATCTGTCATCGATGGCGACATGCTACCGCCGCTCTCGCTGCTGCTGTTGCA
GAAAATGGCGGCTAACACGGCGATTGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGAC
GTGGAAGATGCTCAGAACGACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA