SecReT6
Protein ID: 291281043
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0231
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]253849..254610 [-]
Producthypothetical protein
NoteTssL
UniProt IDD3QWM1
KEGG IDeok:G2583_0231
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.20E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|291281043|ref|YP_003497861.1| hypothetical protein G2583_0231 [Escherichia coli O55:H7 str. CB9615]
MDEGSLSLPPFTGYDEKSLRDYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWLCFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c254610-253849 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCTGCGCGACTACCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCGGCGACGCCGCTACTCGGTATGGTAATGCG
CCTTTCCACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACAGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAACAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCGAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGCGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGCTCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGTACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCTGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA