SecReT6
Protein ID: 291281045
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0233
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]255949..256473 [-]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDD3QWM3
KEGG IDeok:G2583_0233
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|291281045|ref|YP_003497863.1| type VI secretion lipoprotein, VC_A0113 family [Escherichia coli O55:H7 str. CB9615]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPIKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c256473-255949 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGCGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACTGAACCGGACACCAATACCAATGCGGAGGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCAGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGATAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA