SecReT6
Protein ID: 291281046
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0234
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]256470..257480 [-]
Producthypothetical protein
NoteFha
UniProt IDD3QWM4
KEGG IDeok:G2583_0234
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 336 a.a.     [Download]
>gi|291281046|ref|YP_003497864.1| hypothetical protein G2583_0234 [Escherichia coli O55:H7 str. CB9615]
MRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDMLTDTLLSTEGAPHYPGMTHRHQLADTVV
NGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGGINTPFMDLPPIYASPGDHNDDISAAEM
AQRHLAVPPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKGLLDLQQQRNSLSDKHLRPLEDNPLRLN
MDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAAIVESLRVLLDAFSPQNLLRRFVQYRRS
HELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVYDRVLREKQREPEA
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c257480-256470 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
TTGCGCCAGGGCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCGGGGAGATATTC
CCCATTACGATGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTCACGGATACCCT
GCTATCAACGGAGGGTGCGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAGACACCGTGGTA
AATGGTTTTTCTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGGCGATCCGCTTT
CAGGCATTGCGGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGGATCAATACTCC
GTTTATGGATCTGCCGCCCATTTATGCCAGCCCTGGCGATCATAATGATGACATCTCTGCGGCAGAAATG
GCGCAACGCCACCTTGCGGTCCCCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCGTGAGCAATTCCG
ACGATGCGGATGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGTCTGCTCGATTT
GCAGCAGCAGCGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGCTGCGCCTGAAC
ATGGATTACGCCACCGCGCTCGACGTGATGTTTGCCGAAGGTAAAAGCCCGGTACATCTGGCGGCTCCCG
CCGCCGTCAGTGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCGGCGATTGTGGAGTC
GCTTCGTGTCCTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGTACCGCCGCAGC
CATGAACTGCGCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTACGAAGAACTGG
CCTCCGATCGCCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTATGACCGGGTGCT
TCGTGAAAAACAGCGGGAGCCGGAAGCATGA