SecReT6
Protein ID: 291281048
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0236
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]258820..260670 [-]
Producthypothetical protein
NoteTssF
UniProt IDD3QWM6
KEGG IDeok:G2583_0236
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.50E-196, Aligned region: 5..616
Protein Sequence: 616 a.a.     [Download]
>gi|291281048|ref|YP_003497866.1| hypothetical protein G2583_0236 [Escherichia coli O55:H7 str. CB9615]
MEFEERYFREELDYLRQLSKLLATEKPHLARFLAEKDADPDIERLLEGVAFLTGNLRQKIEDEFPELTHG
LIKMLWPNYLRPVPAMTLIEYTPDMDKSSVPVLIPRNEQFTTNAGEIRVDEVLPSDAKKEEPPPCTFTLC
RDIWLLPVRLEQIENRSTTRNGVINITFSVAPGTDFRTLDLNKLRFWLGNDDNYTRDQLYLWFCEYLQGA
DLTVGEQHIRLPEFMLKAVGFEPQDAMLPWPKNVHSGYRILQEYFCYPDAFLFFDLCGCPALPDGLQAEF
FTLQLRFSRPLPVDIRLRRDSLRLYCAPAINLFIHHAEAITLDNRRADYPLVPSRHYPQHYDVFSVNSVV
SQVQDMFRKKDLGRPVSTQAARQWPAFESFSHQMEYSRKREVVYWHHRTKTSLFHRGFDHTLAFIHADGS
YPSDESLLSNEVVSVSLTCTNRELPSQIRSGDITGTTGKNAAVASFRNITRPTQPLWPVIDGSLHWSLLS
AMNLNYLSLLDTDALKQVIANFDRHAIHHPQTARLSQQKLDAIERLETRPVDRLFTGIPVRGLASTLYLH
PEPFVCEGEMYLLGTVLSHFLSLYASVNSFHMLTVVNTESQETWKWTERIGQHPLI
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c260670-258820 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGGAATTTGAAGAACGCTATTTTCGGGAAGAACTCGATTACCTGCGCCAGCTTAGCAAGCTGCTGGCAA
CGGAAAAACCCCATCTGGCCCGCTTCCTGGCCGAAAAAGATGCGGATCCGGATATTGAACGCCTGCTGGA
AGGGGTGGCTTTTCTTACCGGCAATCTCCGCCAGAAAATTGAGGATGAATTCCCAGAACTGACGCACGGG
CTTATTAAGATGCTATGGCCTAATTACCTGCGTCCGGTTCCGGCAATGACCCTTATTGAATATACGCCGG
ATATGGATAAGTCTTCTGTACCGGTGTTAATCCCCCGTAATGAGCAGTTTACAACCAACGCCGGGGAAAT
CAGAGTTGATGAAGTGCTGCCCTCTGATGCTAAAAAGGAGGAGCCGCCTCCCTGTACCTTCACCCTCTGC
CGGGATATCTGGCTGCTGCCCGTTCGCCTGGAGCAGATTGAAAACCGCAGTACGACCCGTAATGGTGTTA
TCAACATCACCTTTTCGGTCGCACCGGGAACGGACTTCCGCACGCTGGATCTGAACAAACTTCGCTTCTG
GCTCGGCAATGACGACAACTATACCCGTGACCAGCTTTATTTATGGTTCTGCGAATACTTGCAGGGTGCC
GACCTGACTGTGGGTGAACAGCATATTCGCCTGCCTGAGTTTATGCTAAAAGCTGTCGGTTTTGAGCCGC
AGGATGCCATGCTGCCCTGGCCGAAAAACGTCCACAGCGGCTACCGGATCCTTCAGGAGTATTTCTGTTA
CCCCGATGCGTTTCTCTTTTTTGATCTTTGTGGTTGTCCGGCTTTGCCTGACGGATTGCAGGCGGAATTC
TTTACCCTGCAACTGCGTTTTTCGCGCCCTTTGCCCGTGGACATCCGGCTGCGCCGCGATTCCCTGCGCC
TGTATTGCGCACCTGCCATTAATTTATTTATCCACCATGCAGAAGCCATCACGCTGGACAACCGGCGGGC
AGACTATCCGCTGGTTCCCAGCCGCCATTACCCACAACATTACGATGTATTTTCCGTTAACAGTGTGGTG
AGCCAGGTCCAGGATATGTTCAGGAAAAAAGATCTGGGGCGTCCTGTTTCGACGCAGGCCGCGCGCCAGT
GGCCAGCCTTTGAAAGTTTCAGCCATCAGATGGAATACAGCCGGAAGCGGGAAGTGGTGTACTGGCATCA
CCGGACCAAAACATCCCTGTTCCATCGCGGCTTTGATCATACCCTTGCCTTTATACATGCTGATGGCAGT
TATCCGTCAGACGAATCTCTGCTCAGTAATGAAGTGGTTTCGGTATCGCTGACCTGTACCAACCGTGAGC
TTCCGTCACAAATTCGTTCCGGCGATATCACCGGCACAACCGGTAAAAATGCGGCTGTTGCTTCCTTTCG
CAACATTACCCGCCCGACGCAACCACTCTGGCCGGTCATTGATGGCAGCCTGCACTGGTCCCTGCTCTCC
GCCATGAACCTGAATTATCTGTCATTACTGGATACGGACGCGCTGAAGCAGGTCATCGCCAACTTTGATC
GCCACGCAATCCACCATCCGCAGACGGCGCGGCTGTCACAACAAAAGCTGGATGCCATTGAGCGTCTGGA
GACCCGCCCCGTTGATCGCCTGTTTACGGGTATTCCCGTCCGGGGACTGGCCTCCACGCTGTATCTGCAC
CCGGAGCCGTTTGTCTGTGAAGGGGAAATGTATCTGCTCGGTACGGTGCTTTCGCATTTTCTGTCGCTGT
ACGCCAGCGTTAACTCATTCCACATGCTGACCGTTGTGAACACAGAAAGCCAGGAGACATGGAAATGGAC
GGAAAGAATCGGGCAGCATCCTCTTATCTGA