SecReT6
Protein ID: 291281049
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0237
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]260674..261087 [-]
Producthypothetical protein
NoteTssE
UniProt IDD3QWM7
KEGG IDeok:G2583_0237
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-18, Aligned region: 29..118
Protein Sequence: 137 a.a.     [Download]
>gi|291281049|ref|YP_003497867.1| hypothetical protein G2583_0237 [Escherichia coli O55:H7 str. CB9615]
MIPDRERTTGSLFERMEASSARNRQGGSIHSLRQSIRQNLRNILNTRSGSCRGAPELGIDEPEGAENFRE
SMSRAIEQCIERYEPRISHAEVQAVVSSASSPLDMTFHITAWVTFNETHEVLEFDMAPNGSQHYRVD
 
Nucleotide Sequence: 414 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c261087-260674 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGATACCGGATCGGGAAAGAACCACAGGTTCTCTTTTTGAGCGTATGGAAGCCTCTTCGGCCAGAAACC
GGCAGGGAGGCAGTATTCATTCGCTCAGGCAATCCATTCGCCAGAACCTAAGAAACATTCTTAATACCCG
GTCCGGTAGTTGCCGGGGTGCGCCTGAGCTGGGCATTGATGAACCGGAAGGGGCTGAAAACTTCCGCGAA
TCCATGAGTCGGGCCATCGAGCAATGTATAGAACGCTATGAACCCCGGATCTCACACGCTGAAGTGCAGG
CAGTGGTTTCATCCGCCTCCAGCCCGCTGGATATGACGTTTCATATTACAGCCTGGGTGACATTTAACGA
AACGCATGAGGTGCTTGAATTTGATATGGCACCGAATGGCAGCCAGCATTACCGGGTGGACTGA