SecReT6
Protein ID: 291281050
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0239
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]262620..262844 [-]
Producthypothetical protein
NoteTssC
UniProt IDD3QWM8
KEGG IDeok:G2583_0239
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|291281050|ref|YP_003497868.1| hypothetical protein G2583_0239 [Escherichia coli O55:H7 str. CB9615]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c262844-262620 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA