SecReT6
Protein ID: 291281051
SecReT6 ID383
T6SS typei1
Gene symbol-
Locus tagG2583_0240
StrainEscherichia coli O55:H7 str. CB9615
Repliconchromosome [GenBank: NC_013941] [Browse all T6SS(s) in this replicon]
Location [Strand]262879..263379 [-]
Producthypothetical protein
NoteTssB
UniProt IDD3QWM9
KEGG IDeok:G2583_0240
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.70E-55, Aligned region: 7..162
Protein Sequence: 166 a.a.     [Download]
>gi|291281051|ref|YP_003497869.1| hypothetical protein G2583_0240 [Escherichia coli O55:H7 str. CB9615]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGQVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|291280824|ref|NC_013941.1|:c263379-262879 Escherichia coli O55:H7 str. CB9615 chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAACGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCTCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACCGTCCCCGCCACGCTGAAGGGAAGCACAACGGACGATGAACTGAATG
TGGCGCTGAATATCAAGTCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGCCAGGTGA
GCAATAAATAA