SecReT6
Protein ID: 29142961
SecReT6 ID45
T6SS typei3
Gene symbol-
Locus tagt2585
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T6SS(s) in this replicon]
Location [Strand]2665037..2665462 [-]
Producthypothetical protein
NoteSTY0301 (i)
UniProt IDQ8Z968
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 141 a.a.     [Download]
>gi|29142961|ref|NP_806303.1| hypothetical protein t2585 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MQKPILSLNSTCIVGGILWLLPVIVVHADEIVCPAVIHFSQAPIISSAEGWNVSSRAARMLNDGGFLSSG
DPKEQADLKGEDAVVDGKKGHLWEIDPEDNRRGIWFSCSYGQWAVLLARKVQGTVATCWSPDVLPAKLIC
K
 
Nucleotide Sequence: 426 bp     [Download]
>gi|29140543|ref|NC_004631.1|:c2665462-2665037 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGCAGAAGCCTATTTTATCGTTGAATAGCACCTGTATTGTCGGGGGCATTCTGTGGTTACTTCCGGTAA
TAGTTGTTCATGCCGATGAGATTGTCTGCCCTGCGGTTATTCATTTTTCTCAGGCTCCAATAATTTCCTC
AGCGGAAGGATGGAATGTCTCATCCCGTGCAGCGCGTATGTTGAATGATGGTGGTTTTCTTTCGTCTGGC
GATCCCAAAGAGCAGGCAGATCTGAAAGGTGAAGATGCAGTCGTTGATGGGAAAAAGGGGCACCTGTGGG
AGATAGACCCAGAGGATAATCGCCGGGGGATCTGGTTCTCGTGTAGTTATGGACAGTGGGCTGTTCTGCT
TGCCAGAAAAGTTCAGGGAACGGTTGCGACATGCTGGAGCCCGGATGTCTTACCGGCGAAATTGATTTGT
AAATAA