SecReT6
Protein ID: 29142969
SecReT6 ID45
T6SS typei3
Gene symbol-
Locus tagt2594
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T6SS(s) in this replicon]
Location [Strand]2672322..2673146 [+]
Producthypothetical protein
NoteTagJ
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 7.30E-46, Aligned region: 143..266
Protein Sequence: 274 a.a.     [Download]
>gi|29142969|ref|NP_806311.1| hypothetical protein t2594 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MKKTDTLPATLSALLQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWARALHQLQLCARMEAN
YTQEARLYRELVCCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDTGG
QWNGGAFDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDLLWKPVNITLVNGDTHGAWL
FTRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMTHCTFHAQENDGA
 
Nucleotide Sequence: 825 bp     [Download]
>gi|29140543|ref|NC_004631.1|:2672322-2673146 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGAAAAAAACTGACACGCTTCCTGCTACCCTGTCCGCGCTGCTACAGGAATACTCTATTGCGGAGGGGA
TTCAGATGGCGGAGCAGCAGGTTCGGGAAAATCCGGCGAAGGCGCTCTGCCGCCACAGCCTGTTTCAGTT
GCTGTGTGTGGCCGGAGACTGGGCGCGGGCGCTACACCAGCTTCAGCTCTGTGCCAGGATGGAGGCAAAT
TATACCCAGGAGGCCCGGCTGTACCGGGAGCTGGTTTGCTGCGAAATGTTCCGCCACACCGTTTTTCAGG
GTGAACAACGACCCGGTTTTCTTCTGCCGCAGCCCGTTTGGGTGGAGTCACTGCTGGCGGCACTCGCCTG
TCATGACGATACCGGTGAGGTTGATAAACACCGTAATACCGCACTGGAAGCCATAACAGACACGGGCGGG
CAGTGGAACGGCGGCGCATTTGACTGGGCGAGCGACAGCGATTCCCGCCTTGGCCCGGTACTTGAGCTGG
TCACCGGCGGCGTGTATATCTGGCTACCGTTTTCGCAAATACGCTCGCTGGAATCGCCGCAACCGACGCG
CCTGACCGATCTGCTGTGGAAACCCGTTAATATCACCCTGGTGAATGGCGATACGCACGGTGCCTGGCTC
TTTACCCGTTACAGCGGTTCGGAAAGTGCATCTGACGCCCTGCGTCTGTGCCGGGAAACCGCCTGGCAGG
ACGGCCCCGGCGAAACCACCGTGCGAGCGCTGGGGCAGAAAGTGTGGCTGACCAGCCACGGCGATATCAG
CCTGCTGGACATGACCCATTGTACCTTTCATGCTCAGGAAAACGATGGCGCATGA