SecReT6
Protein ID: 29142970
SecReT6 ID45
T6SS typei3
Gene symbol-
Locus tagt2595
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T6SS(s) in this replicon]
Location [Strand]2673143..2673637 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ8Z977
KEGG IDstt:t2595, sty:STY0290
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.10E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|29142970|ref|NP_806312.1| hypothetical protein t2595 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDEARQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|29140543|ref|NC_004631.1|:2673143-2673637 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCTACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGTCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGCCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCACAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATGAAGCCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA