SecReT6
Protein ID: 29142973
SecReT6 ID45
T6SS typei3
Gene symbol-
Locus tagt2598
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T6SS(s) in this replicon]
Location [Strand]2676539..2676961 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ8Z980
KEGG IDstt:t2598, sty:STY0287
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.60E-19, Aligned region: 51..110
Protein Sequence: 140 a.a.     [Download]
>gi|29142973|ref|NP_806315.1| hypothetical protein t2598 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIR
VLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAARWITKA
 
Nucleotide Sequence: 423 bp     [Download]
>gi|29140543|ref|NC_004631.1|:2676539-2676961 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGGACATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGATCCGG
AATACCTGCTGCTGTTCAGCCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCC
GGAAGCCGTGAACTGGCCGGAAATTGAGCGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGG
GTGTTGATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATGCTCACAC
AACTGGCAGAACTGAGCGTAATCTGGTCTGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATC
CGCAGAATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCGCTGGATCACGAAGGCG
TGA