SecReT6
Protein ID: 29142974
SecReT6 ID45
T6SS typei3
Gene symbol-
Locus tagt2599
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T6SS(s) in this replicon]
Location [Strand]2676961..2677593 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ8Z981
KEGG IDsty:STY0286, stt:t2599
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 210 a.a.     [Download]
>gi|29142974|ref|NP_806316.1| hypothetical protein t2599 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MADIRGITLSNSAALHLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQV
WARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPAPAPAGTVMDNAIPARAEDVPPVNAPPGIS
IPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 633 bp     [Download]
>gi|29140543|ref|NC_004631.1|:2676961-2677593 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGGCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGCCCTGCACCTGCAGGTACGGGACGTGGAGC
GCGCGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCAGACCT
CGAAGCCCGTGGGGCATTACCGCTAGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTG
TGGGCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGC
CTGACGTGGTACAGACAACCACGCCGGAAATCCCTCCGTCGCCAGCGCCAGCGCCAGCTCCCGCAGGCAC
GGTTATGGATAATGCCATTCCTGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCT
ATCCCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAACGCCTGCGGTGCATTC
GTCGCTGGTTTGAGAGCAGTGAACCCAGCAGCCCGACCATCCCACTATTACGTCAGGCTGAAAGACTGGT
GGGAAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAG
TGA