SecReT6
Protein ID: 291619683
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4130
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4583032..4584423 [-]
Producthypothetical Protein
NoteTssA
UniProt IDD4GFH7
KEGG IDpam:PANA_4130
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.80E-51, Aligned region: 109..151
DUF3702 [PF12486], Evalue: 1.80E-51, Aligned region: 314..458
ImpA-rel_N [PF06812], Evalue: 2.00E-19, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 2.00E-19, Aligned region: 364..385
Protein Sequence: 463 a.a.     [Download]
>gi|291619683|ref|YP_003522425.1| hypothetical Protein PANA_4130 [Pantoea ananatis LMG 20103]
MNDITPRKIKTGGDPRTLQDYASLRNELSKLSHPARPDVNWLYVEKLCLSLFEQNGVELQSAAWYTLARM
QLAGLFGLNEGLAILEALISHQWCALWPQPVHARMEILSSLSQRLQQRMRSLPLNYSDLGQLYRAEQRLT
VMVEVLQRLELKHLSQLDTLRTLMHNSAVRLENSDDTIPTTATSQPGFVLPAPLVKDAGISTGSQAGGPF
ENSSGPGSSVKWVYVAQPEHQANVDVLAAITAPVKKWKPFLAGMSTMLVISTATVWGWHDLHRPDPLQTQ
LAASLAPLPATLTPEQVIRLRQQIPLPQDFIAQTQQQLTRLDQLSPGWNIDYSRQLVEQAQALWPEQAKP
LAQQWQQQRYAAALPAEQLNGWFQGMMSLQKLSDRLNGLDEQKGKYMTVSELKSVVFSTMQSFNQSIPVE
EQLRALSQHPAGEPLPAAARSQLEMHLKQLTARYAEITHQGSQ
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4584423-4583032 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGAATGACATTACTCCACGTAAAATCAAAACCGGTGGCGACCCGCGCACGCTGCAGGATTATGCTTCCC
TGCGCAATGAACTGAGCAAGCTGTCACATCCGGCGCGGCCTGATGTGAACTGGCTCTATGTCGAAAAGCT
CTGCCTTTCACTGTTTGAGCAGAACGGTGTGGAGTTGCAGAGCGCGGCCTGGTATACGCTTGCCCGTATG
CAACTTGCCGGATTATTCGGCCTCAATGAAGGTCTGGCGATACTGGAGGCGCTGATCAGCCATCAGTGGT
GCGCACTTTGGCCGCAGCCTGTTCACGCCCGAATGGAAATTCTCAGCAGTTTGAGCCAGCGCCTGCAGCA
ACGGATGCGCTCGCTCCCGCTGAATTACAGCGACCTCGGTCAGTTGTATCGGGCAGAGCAACGTCTCACC
GTTATGGTGGAGGTGCTGCAGCGTCTGGAGCTAAAACATCTCAGCCAGCTGGATACGTTGCGTACCCTGA
TGCACAACAGTGCTGTCCGGCTGGAAAACAGCGATGACACAATCCCGACAACGGCGACGAGTCAGCCAGG
TTTCGTGCTGCCTGCCCCCCTGGTGAAGGACGCGGGAATATCAACAGGTTCTCAGGCTGGCGGGCCATTT
GAAAACTCCTCAGGGCCAGGTAGCTCAGTGAAGTGGGTGTACGTTGCGCAGCCGGAACACCAGGCCAATG
TGGACGTACTGGCAGCAATAACGGCGCCGGTAAAAAAGTGGAAACCCTTTCTTGCCGGGATGAGTACCAT
GCTGGTAATAAGCACAGCCACAGTGTGGGGCTGGCACGATCTTCACCGGCCTGACCCGTTACAGACTCAG
CTTGCCGCCTCCCTGGCGCCTTTACCTGCCACTCTCACGCCTGAACAGGTGATTAGGTTGCGTCAGCAGA
TTCCCCTGCCGCAGGACTTTATTGCACAGACGCAGCAACAACTGACCCGTCTGGACCAACTTTCGCCAGG
CTGGAACATTGACTACAGTCGGCAGCTTGTAGAGCAGGCTCAGGCGCTATGGCCAGAGCAGGCGAAACCG
CTGGCGCAGCAATGGCAGCAACAACGCTATGCTGCCGCTTTGCCAGCAGAGCAGCTAAATGGCTGGTTTC
AGGGAATGATGTCACTCCAAAAACTGAGTGACAGACTGAACGGACTTGATGAACAAAAGGGAAAATACAT
GACGGTCAGCGAGCTGAAATCAGTGGTTTTTTCCACTATGCAGTCCTTTAACCAATCCATACCGGTTGAA
GAGCAACTGCGGGCATTGTCACAACATCCTGCGGGCGAACCTTTACCTGCCGCTGCCCGGTCTCAACTGG
AAATGCACCTGAAGCAACTGACGGCCCGTTATGCTGAAATAACACACCAGGGTTCACAATAA

Protein ID: 291619690
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4137
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4590811..4592412 [-]
Producthypothetical Protein
NoteTssA
UniProt IDD4GFI4
KEGG IDpam:PANA_4137
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-22, Aligned region: 67..126
Protein Sequence: 533 a.a.     [Download]
>gi|291619690|ref|YP_003522432.1| hypothetical Protein PANA_4137 [Pantoea ananatis LMG 20103]
MSTLQNLIVACQADDAQLQQQAQTHTENWQPWLAPITDTSPTGEDPSYDDDFQRIREEVNKLSGIDTGLI
CTLVEKLLTTTAKDIRIATYYCWARLHQDGENGFAEGLELLAGLLQRYGTQLHPQRERSRKPALEWLAGS
RVLDSLSLWPEVVRDDALRTAGALLLIRDSLEAEPQESRPELNTLYSALESRLMKAGGMDAVVPQNAANK
AKLQAPSHITEPDAPLLSRITSGQDLLAQARTLTAYLREQPNGWLAAHRLMKSLRHDTLHSIPAPDAQGK
TRIEPPRADQRAMLKRLYLQQSWLEILEQADSTFSRGANHLWLDLQWYIHQALVKSGQDIFADIITADLK
GLLRRLIGLETLAFNDGTPFADEVTLNWINQSMLDDTPGWRDEPVSAVSETDNGILALEPEALEKADTDG
LDATLHWLQTRPGTDATKDKWLLRLLMARVAEQKGKNELALHLLEELDSAAQSITLTQWTPALLFEVKSR
RLRLLRMKASRSESDKARLQPEMDLLLSGLIALDPASSAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4592412-4590811 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGAGCACTCTACAGAATCTGATCGTGGCCTGTCAGGCTGACGATGCCCAGTTGCAGCAACAGGCGCAGA
CACACACAGAAAACTGGCAGCCCTGGCTTGCTCCGATAACTGACACCAGTCCGACCGGAGAAGACCCCAG
CTATGACGATGATTTTCAGCGTATCCGGGAGGAGGTCAACAAGCTTTCTGGCATTGATACCGGGCTGATT
TGCACGCTTGTCGAAAAACTGCTGACCACCACTGCCAAAGATATCCGAATTGCCACCTATTACTGCTGGG
CGCGTCTGCACCAGGACGGGGAAAACGGATTTGCCGAAGGGCTTGAACTGCTGGCGGGATTGCTACAGCG
CTATGGAACGCAGCTTCATCCTCAGCGTGAGCGGAGCCGTAAACCGGCGCTGGAGTGGCTCGCAGGCTCC
CGCGTTCTGGACAGCCTGTCACTCTGGCCGGAAGTAGTGCGCGACGATGCCCTGCGCACTGCCGGCGCAC
TGCTGCTTATTCGCGACAGTCTGGAGGCAGAGCCGCAAGAGTCACGCCCAGAACTGAATACCCTGTACAG
CGCGCTGGAGTCTCGCCTGATGAAAGCCGGTGGCATGGATGCCGTGGTCCCGCAAAACGCCGCTAATAAA
GCAAAGTTGCAGGCCCCCTCACACATCACCGAACCTGACGCACCGTTACTGAGCCGTATCACGTCCGGTC
AGGATCTGCTGGCCCAGGCCCGTACACTGACGGCGTATCTGCGTGAACAACCCAATGGCTGGCTTGCCGC
ACACCGGCTGATGAAAAGCCTGCGTCATGACACATTGCACAGTATTCCTGCCCCGGATGCACAGGGGAAA
ACCCGAATCGAACCGCCGCGCGCTGACCAGCGGGCGATGCTCAAACGCCTGTACCTGCAGCAGAGCTGGC
TGGAGATACTGGAGCAGGCGGACAGCACCTTTTCGCGCGGTGCCAATCATCTCTGGCTGGATTTGCAGTG
GTATATCCATCAGGCCCTGGTGAAGTCGGGTCAGGACATCTTTGCCGATATTATCACCGCCGACCTGAAA
GGGCTGCTGCGTCGCCTTATCGGGCTTGAAACGCTGGCCTTTAACGACGGTACGCCGTTTGCCGATGAAG
TCACGCTGAACTGGATAAATCAGAGCATGCTCGACGATACGCCGGGCTGGCGTGATGAACCGGTCAGTGC
CGTCAGTGAGACAGATAACGGTATCCTGGCACTTGAACCGGAAGCGCTGGAGAAAGCGGACACTGACGGC
CTTGATGCCACACTTCACTGGCTGCAGACCCGTCCGGGCACCGACGCCACGAAAGACAAATGGTTGCTGC
GTTTGCTGATGGCACGGGTGGCTGAGCAGAAGGGAAAGAATGAACTGGCCCTGCATCTGTTGGAAGAGCT
CGACAGTGCCGCGCAGTCCATCACGCTCACGCAGTGGACACCGGCACTGTTGTTTGAAGTGAAATCCCGT
CGACTCAGACTGCTGCGCATGAAAGCCAGCCGTAGCGAAAGCGATAAAGCGCGGCTTCAGCCTGAGATGG
ACTTACTGCTGTCCGGTCTGATTGCGCTCGATCCGGCAAGCAGTGCGGTGCTTTGCGGGTAA