SecReT6
Protein ID: 291619684
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4131
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4584750..4585205 [-]
Producthypothetical Protein
NoteTssE
UniProt IDD4GFH8
KEGG IDpam:PANA_4131
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.30E-15, Aligned region: 31..117
Protein Sequence: 151 a.a.     [Download]
>gi|291619684|ref|YP_003522426.1| hypothetical Protein PANA_4131 [Pantoea ananatis LMG 20103]
MPQFHQSPSLYELLAGNFSGGLSLNQVSEENQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGM
PGTAHEMMGTLSAVLLKYEPRLKKITVVMLEQKVPGELRYAIDAELKGIGLVRYGTEFMPEGRVLLRHLK
QQQYLDTLTRL
 
Nucleotide Sequence: 456 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4585205-4584750 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGCCTCAGTTTCATCAATCCCCTTCACTGTATGAGCTACTCGCCGGCAATTTCTCCGGTGGTCTGAGCC
TCAATCAGGTGAGTGAGGAAAACCAGGTTATCCTCTCAGTGCTGGATAACATGCAGCGAATCCTCAACTG
TCGCGCCGGAACGCTGGCGCATTTGCCGGATTACGGTTTGCCGGACATGACGAAAATCCTGCAAGGCATG
CCAGGTACGGCCCATGAAATGATGGGCACCTTATCTGCAGTTCTGCTCAAGTATGAGCCACGCCTGAAAA
AAATAACGGTTGTCATGCTGGAACAGAAAGTCCCCGGAGAGCTGCGCTATGCCATTGACGCTGAACTCAA
AGGTATAGGACTGGTGCGCTACGGCACCGAGTTTATGCCAGAGGGGCGGGTCCTGTTGAGGCATCTTAAG
CAACAGCAGTATCTTGATACCTTAACCCGTCTGTGA