SecReT6
Protein ID: 291619685
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4132
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4585205..4585750 [-]
Producthypothetical Protein
NoteTssJ
UniProt IDD4GFH9
KEGG IDpam:PANA_4132
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.20E-29, Aligned region: 19..171
Protein Sequence: 181 a.a.     [Download]
>gi|291619685|ref|YP_003522427.1| hypothetical Protein PANA_4132 [Pantoea ananatis LMG 20103]
MLHTSLTKSARWLLPMLAIALSGCGLTQSVSDGTKSAFSAVFYKKIKVLHLDFTAREALNTDARENNALS
QSVVLRIYQLKDIKTFDSSVYQQLLNEGETTLGGIYLPLVMSCLKPGGDVSLNMAMEDDAKYVAVAGLFR
DPDTVKNTWKLTIDREALDPDEARVIEAGSHYLKLLTPKDD
 
Nucleotide Sequence: 546 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4585750-4585205 Pantoea ananatis LMG 20103 chromosome, complete genome
GTGTTACATACAAGTTTGACTAAATCTGCACGCTGGCTGTTACCCATGCTGGCAATCGCGCTTTCCGGTT
GCGGTCTGACCCAAAGCGTCAGCGATGGGACCAAATCGGCCTTTAGCGCGGTGTTTTATAAAAAGATTAA
GGTGCTACATCTGGATTTCACCGCGCGCGAAGCCCTCAATACGGACGCGCGGGAGAACAACGCCTTGTCT
CAATCGGTAGTGCTACGCATTTATCAGCTCAAAGACATCAAAACCTTCGACAGCAGCGTCTATCAGCAAT
TGTTGAATGAGGGAGAAACGACGCTTGGGGGGATCTACTTGCCACTCGTGATGTCGTGCTTGAAGCCCGG
TGGTGATGTCTCGCTGAATATGGCCATGGAAGACGACGCGAAATACGTGGCGGTTGCCGGGCTGTTTCGG
GATCCGGATACGGTGAAAAATACCTGGAAGTTGACGATTGACCGCGAAGCACTCGATCCTGACGAGGCGC
GGGTGATTGAAGCCGGGAGTCATTATCTGAAGTTATTAACGCCAAAGGATGACTAA