SecReT6
Protein ID: 291619686
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4133
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4585728..4586813 [-]
Producthypothetical Protein
NoteTssG
UniProt IDD4GFI0
KEGG IDpam:PANA_4133
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.40E-77, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|291619686|ref|YP_003522428.1| hypothetical Protein PANA_4133 [Pantoea ananatis LMG 20103]
MAREAQPPYSRLTPRLEADLTRINFYRFCQLLEKRNPGRPLMGSTSHPADDPVRFAPHPGMGFPASELKA
VEYNEEDDSKPPLIRTTFMGMYGVDSPLPTAYLDDISQRREGHDVLQDFLDIFSHRILTQFYRIWRKYAY
PATFEPGGTDSISQSLLGLVGLGIPGTAEHIATPVSRFLSLLGVLQQPGKTQEGMQALVSLLAPDTRVQV
SPYCLRPVEVSQPLGFHGDNDFMLDGNTPLGDEAMDANSQLLIALYTDNEQESQGWKPDGLLYQDFLVML
RVYLGWRFKAKITLTTRTRLLAAPPLGEGPFWLGMNGVLGAEDEALPKDIPQTFTTELGYYTGLLPATPQ
QGNQRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4586813-4585728 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGCAAGAGAAGCACAACCGCCGTATTCCCGGCTGACCCCGCGACTGGAAGCTGACCTTACCCGGATTA
ACTTTTACCGCTTCTGCCAGTTGCTGGAGAAGCGTAATCCGGGCAGGCCGCTGATGGGGTCAACGAGCCA
CCCCGCGGACGATCCGGTGCGGTTTGCGCCGCATCCAGGGATGGGTTTTCCGGCCAGCGAACTGAAGGCT
GTCGAATATAACGAGGAGGATGACAGCAAGCCACCGCTGATCCGCACGACGTTTATGGGGATGTACGGTG
TCGATTCTCCTTTGCCGACGGCCTATCTCGATGACATCAGCCAGCGCCGGGAAGGGCATGACGTGCTGCA
GGACTTTCTTGATATCTTCAGCCACCGCATCCTGACGCAGTTTTACCGCATCTGGCGAAAATACGCTTAC
CCGGCCACCTTTGAACCGGGCGGAACCGACAGCATTTCCCAGTCGTTGCTGGGTCTGGTGGGGCTGGGCA
TACCGGGCACCGCTGAGCATATCGCCACACCGGTATCCCGTTTTCTGTCACTGCTGGGCGTACTGCAACA
GCCCGGTAAAACCCAGGAGGGGATGCAGGCACTGGTGAGCCTGCTGGCACCTGATACCAGGGTTCAGGTG
AGCCCGTATTGCCTGCGACCGGTAGAAGTCAGCCAGCCATTGGGCTTTCACGGTGATAACGATTTTATGC
TGGACGGCAACACGCCGCTTGGCGACGAGGCGATGGATGCCAACAGTCAACTGCTGATCGCCCTGTATAC
CGATAACGAACAGGAGTCGCAGGGTTGGAAACCGGACGGTCTGCTTTATCAAGACTTTCTGGTGATGCTG
CGTGTTTATCTCGGCTGGCGATTCAAGGCCAAAATTACCCTGACCACCCGCACCCGGCTGCTGGCCGCGC
CGCCCCTCGGCGAAGGCCCTTTCTGGCTTGGGATGAACGGCGTACTGGGCGCGGAAGACGAAGCTCTCCC
GAAGGATATTCCGCAAACCTTTACGACGGAACTGGGCTATTACACCGGCCTGCTGCCCGCGACACCACAA
CAAGGAAACCAACGTGTTACATACAAGTTTGACTAA