SecReT6
Protein ID: 291619687
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4134
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4586777..4588576 [-]
Producthypothetical Protein
NoteTssF
UniProt IDD4GFI1
KEGG IDpam:PANA_4134
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.80E-179, Aligned region: 21..596
Protein Sequence: 599 a.a.     [Download]
>gi|291619687|ref|YP_003522429.1| hypothetical Protein PANA_4134 [Pantoea ananatis LMG 20103]
MFPLVNTINETTQVFMDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPYVERLFEGFAF
LMGRLREKLDDDLPELTEGLVSLLWPHYLRTIPSMSVVEFTPDWREMKEPMRIVKGFEVSSRPIGEKGTR
CRYSTTKEITLQPLSLDHVRLSTDPDGRSVISLRFNCSALADWTRIDLSLVPLYFNADAPLACAMHEAFT
MNVARLWLRLPGEVDRNALDGHFTALGFGEHDDLWPKGSSSFSGYQLLLEYFTFREKFMFTGLRGLESVA
FPAELPWFEIDVVLAERWEHDFSFTEKHLRLNCVPVINLFPLESDPLTLNALQTEYLLRPMRVQDGHTEI
YAVDSVMSSSQHTYVPFSSFRHKGGMMRHDAPEYYYHTRVRRGPSGLHNTWLILGGEAFDNHTVPEDESL
SLTLTGTNGQLPRRALQSTVLDTMMKTTSTRIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDN
ADVLRGTLALYEWTDSEMNRRRLEAIIEVKHSETERFEQGYLVRGVQIEVTLNSHGFAGRGDICLFGEML
SRFFALYTDIYLFNRLIIILQPNGERLEWQEKHNRRIPG
 
Nucleotide Sequence: 1800 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4588576-4586777 Pantoea ananatis LMG 20103 chromosome, complete genome
GTGTTTCCGCTCGTCAATACTATTAATGAAACTACACAGGTTTTTATGGATGACTTAACCCTGCGTTACT
ACGACGCTGAAATGCGCTACCTGCTGGAAGCGGGCGAAGAGTTTGCCCGCGCTCACCCCGAGCAGGCGGC
AATGCTTAATCTTGATAAAGCGGGCGCGCGCGATCCCTACGTGGAGCGTTTGTTCGAGGGCTTTGCCTTT
CTGATGGGCCGTCTGCGTGAAAAGCTTGATGATGACCTGCCGGAACTGACTGAAGGGCTGGTCAGCCTGC
TGTGGCCGCATTATCTGCGCACCATTCCGTCGATGTCAGTGGTGGAGTTCACTCCTGACTGGCGCGAGAT
GAAAGAGCCGATGCGTATCGTCAAAGGTTTCGAGGTGAGCTCACGGCCGATCGGTGAAAAGGGCACGCGC
TGTCGATACTCCACCACCAAAGAGATAACCCTTCAGCCGTTGTCGCTGGATCACGTCCGCCTGTCAACGG
ATCCGGACGGGCGTTCGGTCATCAGCCTGCGCTTTAACTGCAGCGCGCTGGCCGACTGGACGCGCATCGA
CCTCAGCCTCGTCCCGCTCTATTTCAATGCCGACGCGCCGTTGGCCTGCGCCATGCACGAAGCCTTCACT
ATGAATGTGGCGCGACTGTGGCTGCGTTTGCCTGGCGAAGTGGACCGCAACGCGCTCGACGGGCATTTTA
CCGCGCTGGGCTTTGGTGAACACGACGACCTGTGGCCCAAGGGCAGCAGTAGTTTTAGCGGCTATCAGCT
GCTGCTGGAGTACTTCACCTTTCGCGAAAAATTCATGTTCACAGGTCTGCGCGGACTCGAGAGCGTGGCC
TTTCCGGCGGAGCTTCCCTGGTTTGAGATCGACGTGGTACTGGCAGAACGCTGGGAGCATGACTTCAGCT
TTACCGAAAAGCATCTGCGCCTGAACTGCGTGCCGGTGATTAATCTGTTCCCGCTGGAATCTGACCCGCT
GACGCTCAACGCCCTGCAGACCGAATACTTGCTGCGGCCGATGCGCGTGCAGGATGGGCACACCGAGATT
TACGCTGTGGATTCGGTGATGTCATCGAGCCAGCATACTTACGTGCCGTTCTCCAGCTTCCGTCACAAAG
GCGGGATGATGCGTCATGATGCACCGGAGTATTACTATCATACCCGCGTTCGCCGTGGCCCGTCGGGGCT
GCACAACACCTGGCTTATCCTCGGCGGTGAAGCATTCGATAACCACACAGTGCCGGAAGACGAAAGCCTG
TCGTTGACGCTCACCGGCACCAACGGCCAGCTGCCGCGTCGTGCATTACAAAGCACTGTGCTCGATACGA
TGATGAAAACCACCTCGACCCGTATCGCCGTGCGTAACCTGTGTGCGCCTACGCTGCCCTGTTATCCACC
GGCGCAGGACCGTTTTCACTGGCGAGTGCTGAGCCACCTCGGCAGCGGATTCCTGTCGATGATGGATAAT
GCCGACGTGCTGCGCGGTACCCTGGCGCTTTATGAATGGACCGACAGTGAGATGAACCGCCGTCGACTGG
AAGCGATCATTGAAGTTAAGCACAGTGAAACCGAACGCTTTGAGCAGGGTTACCTGGTGCGCGGTGTGCA
GATTGAAGTGACCCTGAACAGTCACGGTTTTGCCGGGCGTGGCGATATTTGTCTGTTTGGCGAAATGCTG
AGTCGTTTCTTCGCGCTCTACACCGATATCTATCTGTTTAACCGTCTGATCATCATCCTGCAACCAAACG
GAGAACGTCTGGAATGGCAAGAGAAGCACAACCGCCGTATTCCCGGCTGA