SecReT6
Protein ID: 291619698
SecReT6 ID385
T6SS typei2
Gene symbolclpV
Locus tagPANA_4145
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4603720..4606374 [-]
ProductClpV
NoteTssH
UniProt IDD4GFJ2
KEGG IDpam:PANA_4145
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.00E-41, Aligned region: 236..255
AAA_2 [PF07724], Evalue: 3.00E-41, Aligned region: 610..775
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 238..350
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 615..736
AAA [PF00004], Evalue: 5.30E-19, Aligned region: 763..780
AAA_5 [PF07728], Evalue: 1.20E-14, Aligned region: 238..258
AAA_5 [PF07728], Evalue: 1.20E-14, Aligned region: 335..368
AAA_5 [PF07728], Evalue: 1.20E-14, Aligned region: 614..735
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 383..406
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 781..856
AAA_16 [PF13191], Evalue: 8.10E-12, Aligned region: 215..258
AAA_16 [PF13191], Evalue: 8.10E-12, Aligned region: 283..316
AAA_16 [PF13191], Evalue: 8.10E-12, Aligned region: 498..559
AAA_16 [PF13191], Evalue: 8.10E-12, Aligned region: 595..650
AAA_16 [PF13191], Evalue: 8.10E-12, Aligned region: 678..708
AAA_16 [PF13191], Evalue: 8.10E-12, Aligned region: 753..797
AAA_22 [PF13401], Evalue: 1.60E-08, Aligned region: 237..323
AAA_22 [PF13401], Evalue: 1.60E-08, Aligned region: 613..637
AAA_22 [PF13401], Evalue: 1.60E-08, Aligned region: 785..813
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 238..265
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 292..326
AAA_25 [PF13481], Evalue: 5.80E-07, Aligned region: 612..643
Arch_ATPase [PF01637], Evalue: 1.00E-06, Aligned region: 216..252
Arch_ATPase [PF01637], Evalue: 1.00E-06, Aligned region: 290..388
Arch_ATPase [PF01637], Evalue: 1.00E-06, Aligned region: 608..652
AAA_19 [PF13245], Evalue: 9.60E-06, Aligned region: 235..258
AAA_19 [PF13245], Evalue: 9.60E-06, Aligned region: 546..594
AAA_19 [PF13245], Evalue: 9.60E-06, Aligned region: 612..636
AAA_17 [PF13207], Evalue: 9.60E-06, Aligned region: 238..303
AAA_17 [PF13207], Evalue: 9.60E-06, Aligned region: 613..649
AAA_18 [PF13238], Evalue: 2.20E-05, Aligned region: 238..279
AAA_18 [PF13238], Evalue: 2.20E-05, Aligned region: 615..639
Sigma54_activat [PF00158], Evalue: 2.70E-05, Aligned region: 222..252
Sigma54_activat [PF00158], Evalue: 2.70E-05, Aligned region: 587..731
Clp_N [PF02861], Evalue: 3.10E-05, Aligned region: 22..54
Clp_N [PF02861], Evalue: 3.10E-05, Aligned region: 101..123
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 232..258
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 496..512
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 614..632
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 103..132
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 238..266
NACHT [PF05729], Evalue: 4.00E-05, Aligned region: 614..633
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 232..262
Zeta_toxin [PF06414], Evalue: 0.00011, Aligned region: 613..654
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 232..255
AAA_29 [PF13555], Evalue: 0.00012, Aligned region: 612..640
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 238..335
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 613..696
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 239..259
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 615..636
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 712..733
DUF258 [PF03193], Evalue: 0.003, Aligned region: 224..255
DUF258 [PF03193], Evalue: 0.003, Aligned region: 614..626
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 238..264
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 499..535
AAA_23 [PF13476], Evalue: 0.0068, Aligned region: 612..637
SRP54 [PF00448], Evalue: 0.0072, Aligned region: 238..258
SRP54 [PF00448], Evalue: 0.0072, Aligned region: 613..641
Protein Sequence: 884 a.a.     [Download]
>gi|291619698|ref|YP_003522440.1| ClpV [Pantoea ananatis LMG 20103]
MENPAILLRRLNPYCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDSIWQDLL
GWLDRQPRSVRQRPQLCEPIQVLMQEAWLIASLNGEEQIRSHHLLMALIEKQSLVRCDGLWPLLTLGRGQ
LERLRPLLDAQSDERPELQFEVELAQEHGSEVEFVGRPVGAELKEGELTPALQNALDKFTLDVTAKAKEG
KIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAGGNVPDSLKSVALRTLDLGLL
QAGAGVKGEFEQRLKNVIDAVQQSPVPILLFIDEAHTIIGAGNKAGGADAANLLKPALARGELRTIAATT
WSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHGVHITDDAVRAAVTLSRRYLTGRQ
LPDKAVDLLDTAAARVRMSLDTVPDPIVRLKAQLTALALEEQALLDDVAAGSHRHGDRLGVIEQRRAELD
AHIQMQESRFSHEKALAQQLMTSRQDISQRDEIIDLQQQLEQAQQGDALVQIDVDTRTIANVIADWTGVP
LSSLMKDEQTELLTLENEIGRRVVGQQPSLKAIAQRLRAAKTGLTSENGPLGVFLLVGPSGVGKTETALA
LAEVLYGGEKSLITLNLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVM
NLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDHLMQRLDEQPDATEGDLHELLRPILRDHFQPALL
ARFQTVIYRPLSQAAMRTIVEMKLGQVSQRLNRHYCLTTHIDESLYDALTTACLLPDTGARNVDSLLNQQ
ILPVLSQQLLTHMAAKQKPQSLSLSWSEEEGIGLAFGPTQGVHA
 
Nucleotide Sequence: 2655 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4606374-4603720 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGAAAATCCAGCCATCCTGTTGCGACGTCTGAACCCTTACTGTGCCCGTGCGATGGAAGGGGCGGCTT
CGCTCTGCCAGACCCGCGCCCACGCGGAAATTTTACCGGAGCACTGGCTGCTGAAACTGCTGGAGCAGGG
CGAGGGCGATCTCACGGTACTGGCGCGGCGTTATGAGTGGGATATGGACAGCATCTGGCAGGATTTGCTG
GGCTGGCTGGATCGACAACCGCGCTCAGTGCGCCAACGTCCACAACTCTGCGAACCTATCCAGGTGTTGA
TGCAGGAAGCCTGGCTGATTGCTTCGCTCAACGGTGAAGAACAGATCCGCAGTCACCACCTGTTGATGGC
CTTAATTGAAAAACAGAGTCTGGTCCGCTGCGATGGTCTGTGGCCGCTACTGACGCTGGGCCGGGGACAA
CTGGAGCGCTTGCGACCGCTGCTGGATGCGCAGTCCGACGAACGCCCGGAGCTGCAGTTTGAGGTTGAAC
TGGCCCAGGAGCATGGCAGTGAGGTGGAGTTTGTTGGCCGCCCGGTCGGTGCAGAGCTGAAAGAGGGCGA
GCTGACCCCGGCCCTGCAGAACGCACTGGATAAATTCACTCTCGATGTCACTGCCAAAGCCAAAGAAGGC
AAGATTGATCCGGTATTTGGCCGCGATACTGAAATCCGTCAGATGGTGGACATTCTCTCCCGCCGCCGCA
AGAACAACCCAATCTTGGTCGGTGAACCAGGCGTGGGTAAAACCGCGCTGGTTGAAGGCCTGGCGCTGCG
TATAGCCGGAGGCAATGTACCGGATTCACTCAAGTCAGTTGCTCTGCGCACGCTTGATCTTGGGCTGTTA
CAGGCAGGGGCGGGCGTGAAAGGCGAGTTCGAACAGCGCCTCAAAAACGTCATTGATGCCGTGCAGCAGT
CGCCAGTGCCGATACTGCTGTTTATCGATGAGGCGCACACCATTATCGGGGCGGGCAACAAGGCGGGCGG
TGCCGATGCCGCTAACCTACTGAAACCTGCACTCGCCCGTGGCGAACTGCGCACCATTGCCGCCACGACC
TGGTCTGAATATAAGCAGTACTTCGAGCGCGATGCCGCGCTGGAACGTCGCTTCCAGATGGTGAAAGTGG
ACGAGCCCGACGATGACACGGCCTGCCTGATGCTGCGGGGCCTGAAATCCCGCTATGCCGAACATCACGG
CGTGCACATTACCGACGATGCGGTGCGGGCTGCCGTTACGCTTTCCCGACGTTATTTAACAGGCCGCCAG
TTGCCGGACAAGGCCGTGGATCTGCTGGATACTGCCGCCGCACGTGTACGTATGAGTCTTGATACCGTTC
CGGACCCCATTGTGCGCCTGAAAGCACAACTTACTGCGCTGGCGCTGGAAGAGCAGGCGCTGCTGGACGA
TGTCGCCGCCGGCAGTCATCGCCATGGTGATCGCCTGGGCGTTATTGAGCAACGGCGGGCTGAGTTGGAC
GCACATATTCAGATGCAGGAAAGCCGCTTCAGCCACGAAAAAGCGCTGGCGCAGCAGCTGATGACCAGCC
GGCAGGACATCAGCCAGCGAGATGAAATTATTGACCTGCAACAGCAACTTGAACAGGCGCAGCAGGGGGA
TGCGCTGGTTCAGATCGATGTGGATACGCGCACGATCGCAAATGTTATCGCCGACTGGACCGGCGTGCCG
TTGTCTTCCCTGATGAAAGACGAACAGACGGAACTGCTGACTCTGGAAAACGAAATCGGCCGCCGTGTCG
TCGGCCAGCAGCCTTCCCTTAAAGCCATCGCCCAGCGCCTGCGCGCGGCGAAAACCGGGCTTACTTCCGA
AAATGGCCCACTGGGCGTGTTCCTGCTGGTCGGCCCGAGTGGCGTCGGTAAAACCGAAACCGCGCTGGCG
CTGGCTGAAGTGCTGTACGGCGGCGAAAAATCGCTGATTACCCTTAACCTGTCCGAATACCAGGAGCCAC
ATACCGTATCGCAACTGAAAGGCTCGCCACCGGGTTATGTCGGCTACGGCCAGGGCGGTATCCTCACCGA
AGCTGTGCGCAAGCGTCCCTATAGCGTGGTCCTGCTCGATGAAGTGGAAAAAGCACACCGTGACGTGATG
AACCTGTTCTATCAGGTGTTTGATCGCGGCTTTATGCGCGACGGTGAAGGGCGGGAAATCGACTTCCGCA
ACACGGTTATTCTGATGACCTCGAACCTGGGCAGCGACCACCTGATGCAGCGGTTGGATGAACAACCAGA
CGCCACCGAAGGCGACCTGCACGAACTGCTGCGCCCGATCTTACGTGATCACTTCCAGCCCGCGCTGCTG
GCCCGCTTCCAGACGGTAATTTACCGCCCGCTGTCGCAAGCGGCGATGCGCACCATCGTGGAGATGAAAC
TGGGGCAGGTAAGCCAGCGCCTGAATCGTCACTATTGCCTGACCACGCATATTGATGAGAGCCTGTACGA
TGCGCTGACGACGGCCTGCCTGCTGCCGGACACCGGCGCACGCAACGTCGACAGCCTGCTCAATCAACAA
ATTCTGCCCGTGCTGAGTCAGCAGTTGCTGACCCACATGGCGGCGAAACAGAAACCACAGTCGCTAAGCC
TTAGCTGGAGTGAAGAAGAGGGTATCGGGCTGGCGTTCGGCCCCACACAGGGAGTGCACGCATGA