SecReT6
Protein ID: 291619700
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4147
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4607044..4608831 [-]
Producthypothetical Protein
NoteTagL
UniProt IDD4GFJ4, D4GFJ4
KEGG IDpam:PANA_4147
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.00E-17, Aligned region: 465..561
Protein Sequence: 595 a.a.     [Download]
>gi|291619700|ref|YP_003522442.1| hypothetical Protein PANA_4147 [Pantoea ananatis LMG 20103]
MVGTGSLAGSDAVYPVAGSRKMSPAQQRGLALWAALLSAVVCLGFLPVSRLVSVLILLTVLGLIIAFWSV
ASRRAEQNVILQLDDLPEASYRQPVVLVCGDLPLACMQQSPVLTVTQGCWIRVEDQQDPEQVARQVLWLR
PDWGGQLSVMVCICPQKQADSEALTRRLLALRWQISQLRKATGHSVPLILNCQIGSAMTNELLWQAAIAG
EGVRIWRESSAPLSIAEWGTTGGAPAMQQQVLMNSLRGWFCQHVQPVFTDKNADVPVIAPAAVLWGMGPI
LTGSLATSLWSAWLSRHTAMQQVTGWQPVGKDDPVLPPLPDFILPLLPQGQGMTPRGKTLGYACTLFTLA
ALAALLSSGWNNRQLLHRVSFDISRYDRIPMHDFEAKAAAVAVLRDEAAKLDSWARNGVPVRMSLGLYQG
ERLRMPVLDAIRSYVPPSVPSSVPAEPRSTSIPVPKIVRLDSMSLFDSGKSALKDGSTKMLVNSLVGIKA
KPGWLIIVSGHTDNTGNPQLNQALSLKRAEAVRNWMRDTGGVPESCFAVQGYGESRPVAANGTPEGRALN
RRVEISLVPQANACQIPDHPLASSQDDGASQHNGE
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4608831-4607044 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGGTGGGGACTGGATCACTGGCTGGATCGGACGCTGTTTACCCTGTTGCCGGGAGCCGTAAAATGAGCC
CCGCACAACAGCGCGGACTTGCGCTGTGGGCCGCCCTGCTGAGTGCAGTGGTCTGCCTGGGTTTCCTGCC
TGTATCGCGACTGGTTTCTGTGCTCATTCTGCTCACCGTTCTGGGGCTTATCATCGCATTCTGGTCTGTG
GCCAGTCGTCGTGCGGAGCAGAATGTCATCCTGCAACTGGATGATCTGCCAGAAGCCTCTTATCGTCAGC
CCGTGGTGCTGGTCTGTGGCGATCTGCCGCTGGCATGTATGCAGCAGTCACCGGTACTCACTGTCACGCA
GGGATGCTGGATCCGCGTGGAGGACCAGCAGGACCCGGAGCAGGTTGCCCGTCAGGTGCTGTGGCTGCGT
CCTGACTGGGGAGGTCAGCTGTCGGTGATGGTCTGTATCTGCCCACAAAAACAGGCTGACAGCGAAGCCC
TGACCCGTCGTCTGCTGGCTCTGCGCTGGCAAATCAGCCAACTGCGTAAAGCAACCGGTCATTCTGTGCC
GCTGATTCTGAATTGTCAGATCGGCAGCGCGATGACAAATGAACTGCTCTGGCAGGCGGCTATCGCGGGG
GAAGGGGTGAGGATCTGGCGTGAGTCCTCAGCACCGTTGTCAATCGCTGAATGGGGCACCACCGGAGGAG
CACCGGCGATGCAGCAGCAGGTGCTAATGAACAGCCTCAGAGGCTGGTTCTGTCAGCATGTCCAGCCTGT
CTTCACGGATAAGAACGCCGATGTTCCTGTCATCGCACCTGCCGCAGTGCTGTGGGGAATGGGGCCGATC
CTTACCGGAAGCCTGGCGACGTCGCTCTGGTCGGCGTGGCTTTCGCGTCACACCGCAATGCAGCAGGTGA
CGGGATGGCAACCGGTTGGAAAGGACGATCCGGTTCTCCCCCCACTCCCGGATTTTATTCTGCCGCTGCT
GCCGCAAGGGCAGGGCATGACGCCCCGTGGCAAAACCTTAGGCTATGCATGCACTCTTTTCACCCTTGCA
GCCCTTGCTGCTCTGCTCAGCAGTGGCTGGAACAATCGCCAGCTGTTGCATCGCGTGAGCTTCGATATTT
CCCGCTATGACCGTATCCCGATGCATGATTTTGAAGCTAAGGCCGCGGCCGTTGCCGTTCTGCGTGACGA
GGCGGCAAAACTGGATAGCTGGGCGCGCAATGGCGTACCGGTCCGGATGAGCCTCGGTCTTTATCAAGGC
GAGCGCCTGCGAATGCCGGTGCTGGATGCTATCCGTTCGTATGTACCGCCCTCCGTGCCTTCATCCGTGC
CGGCAGAACCCCGGTCAACATCCATTCCGGTCCCGAAAATCGTGCGGCTCGACAGTATGTCGCTGTTTGA
TTCTGGCAAATCGGCGCTGAAAGACGGGTCCACCAAAATGCTGGTGAACTCACTGGTCGGCATCAAAGCG
AAGCCAGGCTGGCTGATTATCGTATCCGGGCATACCGATAACACCGGCAATCCGCAATTAAACCAGGCGC
TGTCTCTGAAGCGTGCCGAAGCGGTGCGTAACTGGATGCGTGATACCGGCGGCGTGCCGGAAAGCTGTTT
CGCGGTGCAGGGCTATGGTGAAAGCCGCCCTGTCGCTGCCAATGGCACCCCGGAAGGGCGCGCGCTCAAC
CGCCGTGTCGAAATCAGTCTGGTACCTCAGGCGAATGCCTGTCAGATACCGGACCACCCCCTGGCGTCAT
CGCAGGATGATGGCGCATCACAACACAATGGAGAGTAA