SecReT6
Protein ID: 291619701
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4148
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4608765..4609454 [-]
Producthypothetical Protein
NoteTssL
UniProt IDD4GFJ5
KEGG IDpam:PANA_4148
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-39, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|291619701|ref|YP_003522443.1| hypothetical Protein PANA_4148 [Pantoea ananatis LMG 20103]
MSEHKRGAAASIDIDALLQDTWLQVISLRHGPEFHDGEGRTLWERCIADVGRVQRELKASELDETSCQHI
LTAQCALLDEAVKGRGVEDDACVQWYHIPLQGHFLGTMDAGDTLCDRMRDVLREPAPDNTVVTCFQRVMM
LGFLGSFRALDDPERQKLVKALSEHVAPFSYPQTHPVVVESRIRRGTGGWMASWPVRIGLSVVVVAALWW
GLDHWLDRTLFTLLPGAVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4609454-4608765 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGAGTGAGCATAAACGCGGCGCTGCCGCGTCCATTGATATTGATGCCCTGCTGCAGGATACCTGGCTGC
AGGTGATCAGCCTGCGTCACGGCCCTGAATTTCACGATGGCGAAGGGCGCACGCTTTGGGAGCGCTGCAT
CGCTGATGTCGGGCGAGTGCAGCGCGAGCTGAAAGCGAGTGAACTTGATGAAACCAGCTGCCAGCATATT
CTCACTGCACAGTGCGCGCTGCTCGATGAGGCGGTCAAAGGTCGTGGTGTGGAAGATGACGCCTGTGTGC
AGTGGTATCACATTCCCCTGCAGGGGCACTTCCTCGGCACAATGGACGCCGGAGATACGCTGTGCGATCG
GATGCGCGATGTGCTGCGTGAACCGGCTCCTGACAATACAGTGGTGACCTGCTTCCAGCGGGTCATGATG
CTGGGATTCCTCGGCAGTTTTCGCGCGCTGGACGATCCGGAACGTCAGAAACTCGTCAAAGCACTCAGCG
AACATGTTGCGCCGTTCAGCTATCCACAAACCCATCCGGTAGTGGTGGAAAGTCGTATCAGAAGGGGCAC
GGGCGGCTGGATGGCATCATGGCCTGTGCGTATTGGCTTGAGCGTTGTCGTGGTGGCCGCACTATGGTGG
GGACTGGATCACTGGCTGGATCGGACGCTGTTTACCCTGTTGCCGGGAGCCGTAAAATGA