SecReT6
Protein ID: 291619702
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4149
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4609451..4610791 [-]
Producthypothetical Protein
NoteTssK
UniProt IDD4GFJ6
KEGG IDpam:PANA_4149
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-136, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|291619702|ref|YP_003522444.1| hypothetical Protein PANA_4149 [Pantoea ananatis LMG 20103]
MKTEQPLWGRGVMVSPQHFQQQVAYAAWSAESIARMGLSQPWGVINVAFEPETLKLGRLQARHLHIRFPD
GTLIDTDNADDLPPVLALESESQDVVVVLALPLLRANGGNCLKPDEVAERPVRYRQRWRDVRNTFGDDIR
QIAVMQPELTLRFAHQDNSDYLTCPVARLQQDSQGSWQLDETFLPPLLSIQGSRWLVSQLEQLMTQLRAR
LSRLMAMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRHPQSPPERLYPELARLAGSLLTFSLE
HQVSAIPVWQFMQLNNVFPPLFDLLSDLLEASLPSRVVAIELENDARLHVWQARLHDPRLREGADYYLSV
RSPMPAAQLQEQFPHQCKVGSPDHVRSIVNSSRVGVPLTPLRHVPAAIPLRLENQYFSLDVSHPLATEML
QGGTCMFYVPGMLGEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4610791-4609451 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCGTAATGGTCTCTCCTCAACACTTCCAGCAACAGGTCG
CGTATGCGGCCTGGTCTGCCGAAAGTATCGCCAGGATGGGGTTATCACAGCCCTGGGGCGTGATAAATGT
CGCTTTTGAACCGGAAACGCTGAAACTGGGCCGCCTGCAGGCCCGCCATCTGCACATTCGTTTCCCTGAC
GGAACGCTAATCGATACGGATAATGCTGACGATCTACCGCCGGTGCTGGCGCTTGAAAGTGAGTCACAGG
ACGTGGTGGTGGTTCTGGCGCTTCCGCTGCTGCGGGCGAATGGTGGCAACTGCCTTAAACCTGATGAGGT
GGCCGAGCGTCCGGTTCGTTATCGCCAGCGCTGGCGCGATGTACGCAATACTTTTGGCGACGATATCCGC
CAGATTGCGGTGATGCAGCCAGAGCTGACGCTGCGGTTTGCCCATCAGGACAACAGCGATTATCTGACCT
GCCCGGTTGCCCGCCTGCAGCAGGATTCGCAGGGTTCATGGCAACTTGATGAGACGTTTCTTCCTCCGCT
TTTGTCCATCCAGGGCAGCCGCTGGCTGGTGAGTCAGTTGGAACAGTTGATGACGCAACTACGTGCCCGT
CTGAGTCGTCTGATGGCCATGCGCCGTGAAAGTAACGAACGTATGGCTGATTTTGCCGTGGCCGACGTGT
CCTTGTTCTGGCTGCTTAATGCCCTGAACAGCGCTGAGCCTGTGCTGGGTCAGTTTCAGCGTCACCCGCA
AAGCCCGCCGGAGCGTCTGTATCCTGAACTTGCGCGGCTTGCGGGCAGCCTGCTGACCTTCTCACTCGAA
CACCAGGTGAGTGCGATTCCTGTCTGGCAGTTTATGCAACTAAATAACGTCTTCCCGCCGCTGTTTGATT
TACTCAGCGACTTGCTGGAAGCCAGCCTGCCATCGCGGGTGGTGGCGATTGAGCTCGAAAATGATGCCCG
ACTTCATGTCTGGCAGGCGCGTTTGCATGACCCACGTCTGCGCGAAGGCGCAGATTACTATCTCTCTGTG
CGATCCCCGATGCCGGCGGCACAACTGCAGGAACAGTTCCCGCATCAGTGCAAGGTCGGCAGTCCCGATC
ATGTCAGGAGTATCGTCAATTCATCGCGGGTGGGCGTACCTCTGACGCCACTGCGCCATGTGCCGGCAGC
CATTCCGCTGCGTCTGGAAAACCAGTATTTCAGCCTGGATGTCTCTCATCCCCTTGCCACCGAAATGCTT
CAGGGCGGCACCTGTATGTTTTACGTCCCTGGCATGCTCGGTGAGCCTGAACTTGAACTCTTTGCGGTAC
TGAGAACATGA