SecReT6
Protein ID: 291619704
SecReT6 ID385
T6SS typei2
Gene symbol-
Locus tagPANA_4151
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4612390..4612917 [-]
Producthypothetical Protein
NoteTssB
UniProt IDD4GFJ8
KEGG IDpam:PANA_4151
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.70E-52, Aligned region: 16..168
Protein Sequence: 175 a.a.     [Download]
>gi|291619704|ref|YP_003522446.1| hypothetical Protein PANA_4151 [Pantoea ananatis LMG 20103]
MCSNKSRDDEMTDSFQSEVPKARINLKLDLHTGGASKKTELPLKLLVAGDFSNGQESAPLPERKKVNLNK
NNFDAVLSEYSPKLNLTVKNTLAGDDSEENISLSFQSMQDFSPEQVSRQIPQLKAMLSMRNLLRDLKANL
LDNQAFRKELEKILLDPALSAELRSELSALAPKQP
 
Nucleotide Sequence: 528 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4612917-4612390 Pantoea ananatis LMG 20103 chromosome, complete genome
GTGTGCAGCAATAAATCGAGGGATGATGAAATGACGGATAGTTTTCAGAGTGAAGTGCCAAAGGCACGTA
TTAATTTAAAACTGGATCTGCATACGGGGGGCGCAAGCAAGAAAACGGAGCTCCCTCTGAAATTACTTGT
GGCAGGCGACTTCAGTAATGGTCAGGAGTCTGCACCCCTGCCTGAACGTAAAAAAGTTAATCTGAACAAA
AATAATTTTGACGCTGTACTTTCTGAATATTCCCCAAAATTAAACCTGACCGTTAAAAATACGCTTGCCG
GTGATGACAGCGAAGAAAACATCAGCCTGTCATTTCAGAGCATGCAGGATTTTTCTCCAGAGCAGGTTTC
CCGCCAAATACCCCAGCTGAAGGCCATGCTTTCCATGCGCAATTTGCTGCGTGATTTAAAGGCAAATTTA
CTGGATAACCAGGCTTTTCGAAAAGAGCTGGAAAAAATTCTGCTCGATCCGGCCTTAAGTGCAGAGCTCC
GATCTGAGCTGTCTGCGCTGGCGCCTAAACAGCCATAA