SecReT6
Protein ID: 292489467
SecReT6 ID386
T6SS typei3
Gene symbolvgrG1
Locus tagEAMY_3000
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3102718..3104652 [-]
Producttype VI secretion system effector protein VgrG
NoteTssI
UniProt IDD4I0N9
KEGG IDeam:EAMY_3000
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.50E-73, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.50E-25, Aligned region: 366..459
Gp5_C [PF06715], Evalue: 0.0031, Aligned region: 502..523
Gp5_C [PF06715], Evalue: 0.0031, Aligned region: 537..548
Protein Sequence: 644 a.a.     [Download]
>gi|292489467|ref|YP_003532355.1| vgrG1 gene product [Erwinia amylovora CFBP1430]
MFDRITVQLPMDGLLFWRLSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQGLLNTRYLNGK
ITKVSVSSQALGGTRYAVYTLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVTLEDRLTGSYRSW
EYCVQYQESSFSFISRLMELEGIYYYFRHEADGHTLVLMDAAQQHRPFSGYEAIPYHVTPSGGSTREEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYARIRQEVWQ
AEHQQISAAGTALGLAPGHTFTVLNAPFISDNGEYLTTEAYYEFEENRYASGDGSSGTKHNIAIRVIPSA
VTFRAPPETPWPRTHGPQTAKVVGPKGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRSKDGTPDNANALRFEDKA
GEEQLWIQAERNMDTQVKNDESHQVGGNQSLTVQKTLNCSVSGHYNQQTQHTRTELVGDDYVLNVQGLLN
IASGAGIRLVSGDSMLILDPNGTISLQCSNLQINASGQGEINTGGTLDLNIQQPAKGAAPQPTPGEITSL
VNQAFKAPDSGSDA
 
Nucleotide Sequence: 1935 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3104652-3102718 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGTTTGATCGTATCACCGTGCAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCCTGAGCGGGCGCGAGG
CGCTGTCGCAGTCGTTTGAACTGAGCGTGCAGCTGCTAAGCACCGATGCGCGCATCGAGCGCCGGGCGCT
GCTCGGCCAGCCGATCACCGTATGCATTCCCACTCAGGGGCTGCTGAACACGCGCTACCTGAACGGCAAA
ATCACCAAAGTCTCGGTCAGCAGCCAGGCGCTGGGCGGCACGCGCTATGCGGTGTACACCCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGTGACAAAAATCTGCGCATTTTCCAGGGCCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGCGAGTACAACGTGACGCTGGAAGATCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTCAGCTTTATCAGCCGCCTGATGGAGCTGGAAGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACACGCTGGTGCTGATGGACGCGGCGCAGCAGCACCGGCC
GTTCAGCGGCTACGAGGCGATCCCGTACCACGTCACGCCGTCCGGCGGCAGCACCCGCGAAGAGGGCATC
GGCCTGTGGTCGCTGGAGGACAGCGTAACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGCCTCGCCGCAGCCGGGCGCCATCGACGTCTACGA
CTGGCCGGGGCATTTCGTTGACCACGACCACGGCGAGTTCTATGCGCGCATCCGCCAGGAGGTGTGGCAG
GCGGAGCACCAGCAAATCAGCGCCGCCGGCACCGCGCTGGGGCTGGCGCCGGGCCACACCTTCACGGTAC
TGAACGCGCCGTTTATCAGCGATAACGGCGAGTACCTGACCACGGAGGCGTACTACGAATTTGAAGAGAA
CCGGTACGCCAGCGGCGACGGCAGCAGCGGCACGAAGCACAATATCGCCATCCGCGTGATCCCCTCCGCA
GTGACCTTCCGCGCGCCGCCGGAAACGCCGTGGCCGCGCACCCACGGCCCGCAGACGGCGAAGGTGGTGG
GTCCGAAGGGGGAATCGATCTGGACCGACAGATATGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGGCT
GGCGAAGGGCGACGACACCAGCTCGTGTTGGGTGCGCGTCTCCAGCGCGTGGGCGGGCCAGGGCTACGGC
GGGGTGCAGATCCCGCGGGTGGGCGACGAGGTGGTGGTGGACTTTATCAACGGCGACCCGGACCGGCCAA
TCATCACCGGGCGCGTGTACAACGAGGCCAGCATGCCGCCGTGGGCGCTGCCGGCCGCCGCGACGCAGAT
GGGCTTTATGAGCCGCTCGAAGGACGGCACGCCGGACAACGCCAACGCGCTGCGCTTCGAGGATAAGGCG
GGCGAGGAGCAGCTGTGGATCCAGGCCGAGCGCAATATGGATACCCAGGTGAAGAACGACGAAAGCCACC
AGGTGGGCGGTAATCAGTCTCTGACGGTGCAAAAAACGCTCAACTGCTCGGTATCAGGCCATTATAACCA
GCAGACGCAGCACACGCGCACGGAACTGGTCGGCGATGATTACGTTCTCAACGTGCAGGGCTTGCTGAAT
ATAGCCTCCGGTGCGGGCATCAGGCTGGTAAGCGGTGACAGCATGCTGATCCTTGATCCCAACGGCACCA
TTTCGCTGCAGTGCAGCAACCTGCAGATCAACGCCTCCGGGCAGGGGGAAATCAATACCGGCGGTACGCT
CGATCTCAATATCCAGCAGCCGGCTAAAGGCGCAGCCCCGCAGCCCACGCCGGGTGAGATCACCAGCCTG
GTGAACCAGGCCTTTAAAGCCCCGGATTCAGGGAGCGATGCATGA