SecReT6
Protein ID: 292489470
SecReT6 ID386
T6SS typei3
Gene symbolvgrG3
Locus tagEAMY_3003
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3107565..3109529 [-]
Producttype VI secretion system effector protein VgrG
NoteTssI
UniProt IDD4I0P2
KEGG IDeam:EAMY_3003
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.40E-73, Aligned region: 22..327
Phage_base_V [PF04717], Evalue: 1.60E-25, Aligned region: 366..459
Protein Sequence: 654 a.a.     [Download]
>gi|292489470|ref|YP_003532358.1| vgrG3 gene product [Erwinia amylovora CFBP1430]
MFDRITVQLPMDGLLFWRLSGREALSQSFELSVQLLSTDARIERRALLGQPITVCIPTQGLLNTRYLNGK
ITKVSVSSQALGGTRYAVYNLVMEPDLWPLKRDKNLRIFQGQTVPQIVKTLLGEYNVTLEDRLTGSYRSW
EYCVQYQESSFSFISRLMELEGIYYYFRHEADGHTLVLMDAAQQHRPFSGYEAIPYHVTPSGGSTREEGI
GLWSLEDSVTPGMYSIDDYDFRKPNAWMLQARQNPASPQPGAIDVYDWPGHFVDHDHGEFYARIRQEVWQ
AEHQQISAAGTALGLAPGHTFTVLNAPFISDNGEYLTTEAYYEFEENRYASGDGSSGTKHNIAIRVIPSA
VTFRAPPETPWPRTHGPQTAKVVGPKGESIWTDRYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYG
GVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRSKDGHKDAANALRFEDKA
GHEQIWIHAEKNMDTEVEHCETHDVGIDRHKTIGRDEKSTVKRNMLANVGVDATSNTGAKHTINVGGDQA
VLTMDKQGNALLEATASIRLKVKNNYILITPSAIEIQVAEGDLMAESEKGALFKGTDITLLGGGTNAELS
ANDTVSITGTNATDIKGALVKVNS
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3109529-3107565 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGTTTGATCGTATCACCGTGCAGCTGCCGATGGACGGCCTGCTGTTCTGGCGCCTGAGCGGGCGCGAGG
CGCTGTCGCAGTCGTTTGAACTGAGCGTGCAGCTGCTAAGCACCGATGCGCGCATCGAGCGCCGGGCGCT
GCTCGGCCAGCCGATCACCGTATGCATTCCCACTCAGGGGCTGCTGAACACGCGCTACCTGAACGGCAAA
ATCACCAAAGTCTCGGTCAGCAGCCAGGCGCTGGGCGGCACGCGCTATGCCGTGTACAACCTGGTGATGG
AGCCGGACCTGTGGCCGCTGAAGCGTGACAAAAATCTGCGCATTTTCCAGGGCCAGACGGTGCCGCAGAT
CGTCAAAACCCTGCTGGGCGAGTACAACGTGACGCTGGAAGATCGGCTGACCGGCAGCTACCGCAGCTGG
GAGTACTGCGTGCAGTACCAGGAGAGCAGCTTCAGCTTTATCAGCCGCCTGATGGAGCTGGAAGGGATCT
ACTACTACTTCCGCCACGAGGCGGACGGGCACACGCTGGTGCTGATGGACGCGGCGCAGCAGCACCGGCC
GTTCAGCGGCTACGAGGCGATCCCGTACCACGTCACGCCGTCCGGCGGCAGCACCCGCGAAGAGGGCATC
GGCCTGTGGTCGCTGGAGGACAGCGTAACGCCGGGGATGTACAGCATCGACGACTACGACTTCCGCAAGC
CGAACGCGTGGATGCTGCAGGCGCGGCAGAACCCGGCCTCGCCGCAGCCGGGCGCCATCGACGTCTACGA
CTGGCCGGGGCATTTCGTTGACCACGACCACGGCGAGTTCTATGCGCGCATCCGCCAGGAGGTGTGGCAG
GCGGAGCACCAGCAAATCAGCGCCGCCGGCACCGCGCTGGGGCTGGCGCCGGGCCACACCTTCACGGTAC
TGAACGCGCCGTTTATCAGCGATAACGGCGAGTACCTGACCACGGAGGCGTACTACGAATTTGAAGAGAA
CCGGTACGCCAGCGGCGACGGCAGCAGCGGCACGAAGCACAATATCGCCATCCGCGTGATCCCCTCCGCC
GTGACCTTCCGCGCGCCGCCGGAAACGCCGTGGCCGCGCACCCACGGCCCGCAGACGGCGAAGGTGGTGG
GTCCGAAGGGGGAATCGATCTGGACCGACAGATATGGCCGGGTGAAGGTGAAGTTCCACTGGGACCGGCT
GGCGAAGGGCGACGACACCAGCTCGTGTTGGGTGCGCGTCTCCAGCGCGTGGGCGGGCCAGGGCTACGGC
GGGGTACAGATCCCGCGGGTGGGCGACGAGGTGGTAGTCGACTTTATCAACGGCGATCCGGACCGGCCAA
TCATCACCGGGCGCGTGTACAACGAGGCCAGCATGCCGCCGTGGGCGCTGCCGGCCGCCGCGACGCAGAT
GGGCTTTATGAGCCGCTCGAAGGACGGACATAAAGACGCGGCCAACGCGCTGCGCTTTGAAGATAAGGCC
GGTCATGAGCAAATCTGGATCCATGCAGAAAAAAATATGGATACCGAGGTTGAGCACTGCGAAACCCATG
ATGTGGGCATCGATCGCCATAAAACCATTGGCCGCGACGAGAAAAGCACCGTTAAACGCAACATGCTGGC
TAACGTGGGCGTGGATGCGACCAGCAATACCGGGGCGAAACACACCATCAACGTGGGCGGGGATCAGGCC
GTTCTGACCATGGATAAGCAGGGCAACGCGTTGCTTGAAGCCACTGCCAGCATCAGGCTGAAGGTGAAAA
ATAATTATATCCTGATCACCCCCTCAGCCATCGAAATTCAGGTAGCGGAAGGGGACCTGATGGCGGAAAG
CGAGAAAGGGGCCTTATTTAAAGGCACAGACATTACCCTGCTGGGCGGCGGAACCAATGCGGAGCTAAGT
GCTAATGACACCGTCAGCATTACCGGAACCAACGCTACCGATATCAAAGGTGCGCTGGTCAAAGTGAACA
GCTAA