SecReT6
Protein ID: 292489472
SecReT6 ID386
T6SS typei3
Gene symbolclpV1
Locus tagEAMY_3005
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3111012..3113627 [-]
Producttype VI secretion system core protein ATPase
NoteTssH
UniProt IDD4I0P4
KEGG IDeam:EAMY_3005
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-41, Aligned region: 223..245
AAA_2 [PF07724], Evalue: 2.40E-41, Aligned region: 602..767
AAA [PF00004], Evalue: 1.50E-20, Aligned region: 223..355
AAA [PF00004], Evalue: 1.50E-20, Aligned region: 608..692
ClpB_D2-small [PF10431], Evalue: 4.50E-16, Aligned region: 775..850
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 223..300
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 348..372
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 607..727
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 33..80
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 200..243
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 268..302
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 467..526
AAA_16 [PF13191], Evalue: 3.10E-10, Aligned region: 604..652
AAA_22 [PF13401], Evalue: 4.90E-08, Aligned region: 223..303
AAA_22 [PF13401], Evalue: 4.90E-08, Aligned region: 371..390
AAA_22 [PF13401], Evalue: 4.90E-08, Aligned region: 606..631
AAA_22 [PF13401], Evalue: 4.90E-08, Aligned region: 669..690
Sigma54_activat [PF00158], Evalue: 3.70E-07, Aligned region: 208..238
Sigma54_activat [PF00158], Evalue: 3.70E-07, Aligned region: 607..723
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 223..303
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 329..390
AAA_14 [PF13173], Evalue: 1.30E-06, Aligned region: 606..717
AAA_25 [PF13481], Evalue: 6.00E-06, Aligned region: 222..247
AAA_25 [PF13481], Evalue: 6.00E-06, Aligned region: 276..320
AAA_25 [PF13481], Evalue: 6.00E-06, Aligned region: 598..629
NACHT [PF05729], Evalue: 7.20E-06, Aligned region: 223..259
NACHT [PF05729], Evalue: 7.20E-06, Aligned region: 608..634
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 222..247
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 605..629
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 206..242
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 607..627
IstB_IS21 [PF01695], Evalue: 2.20E-05, Aligned region: 718..740
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 223..264
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 607..643
Zeta_toxin [PF06414], Evalue: 7.10E-05, Aligned region: 222..243
Zeta_toxin [PF06414], Evalue: 7.10E-05, Aligned region: 601..657
Zeta_toxin [PF06414], Evalue: 7.10E-05, Aligned region: 782..816
Clp_N [PF02861], Evalue: 8.40E-05, Aligned region: 28..75
Clp_N [PF02861], Evalue: 8.40E-05, Aligned region: 105..123
AAA_29 [PF13555], Evalue: 0.00044, Aligned region: 214..239
AAA_29 [PF13555], Evalue: 0.00044, Aligned region: 605..632
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 223..243
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 609..632
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 797..856
FtsK_SpoIIIE [PF01580], Evalue: 0.00086, Aligned region: 209..266
FtsK_SpoIIIE [PF01580], Evalue: 0.00086, Aligned region: 469..517
FtsK_SpoIIIE [PF01580], Evalue: 0.00086, Aligned region: 606..625
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 202..237
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 276..307
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 356..396
Arch_ATPase [PF01637], Evalue: 0.0017, Aligned region: 606..646
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 224..244
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 608..629
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 705..726
SRP54 [PF00448], Evalue: 0.0058, Aligned region: 222..243
SRP54 [PF00448], Evalue: 0.0058, Aligned region: 606..640
T2SE [PF00437], Evalue: 0.0061, Aligned region: 207..240
T2SE [PF00437], Evalue: 0.0061, Aligned region: 602..684
RuvB_N [PF05496], Evalue: 0.007, Aligned region: 221..240
RuvB_N [PF05496], Evalue: 0.007, Aligned region: 278..303
RuvB_N [PF05496], Evalue: 0.007, Aligned region: 576..628
RuvB_N [PF05496], Evalue: 0.007, Aligned region: 676..700
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 223..235
Hpr_kinase_C [PF07475], Evalue: 0.0099, Aligned region: 605..625
Protein Sequence: 871 a.a.     [Download]
>gi|292489472|ref|YP_003532360.1| clpV1 gene product [Erwinia amylovora CFBP1430]
MSEISRAVLFGKLDTLLFTSLESATAFCKLRGNPYVELVHWLHQLMQQQSGDLQQLIRHFSLDEEALTRD
IVAALDRLPRGASAVSDLSEHIDSAVERAWVYASLKFGVQQIRGGHLLTGLLKTFNLANLLKGISPQFSR
VSVDVLLEQFDRVFGDSKEARQVSAAPQTPGGEVPQQQGTLAQYAQDLTARARDGKIDPVAGRDQEIRQM
VDILMRRRQNNPLLTGEAGVGKTAVVEGLALRIAAGDVPEPLQQVQLWLLDIGMLQAGAGMKGEFEARLQ
ALINEVQSSPTPIVLFIDEIHTLVGAGGQQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIEKDPALT
RRFQTVQVHEPDEEKALLMLRSTVSPLEQHHRILLLDEAVAAAVKLSHRYIPARQLPDKAVALLDTACAR
VAVSQSARPPQLEDCLHRIHALEIERDIAGREAKVGIGEAGRVTQLEQQLAELAAQRDRLNARWQQERSL
VDSLIALRAQLSAETAENPANLHQQLAERQQQLRELQGDTPLLFAAVDANVVAAVVADWTGIPLGRMVKN
EIDAVLKLADTLNQRVIGQRHGLDLIAKRVRTSRARLDDPNKPVGVFMLCGPSGVGKTETALALAETLYG
GEQNIITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVF
DKGWMEDGEGRHIDFRNTIIILTSNVGTQLISAMCADPELMPQPEDLAGALRPALLEVFPPALLGRLLVV
PYYPLSDEVLANIVRLQLQRIQRRLQENHGIISDVDDSVISQIVQRCTEVESGGRMVDAILTNTLLPQMS
QMLLSASARDEQFRRLRVTLQQGEFQCQFEA
 
Nucleotide Sequence: 2616 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3113627-3111012 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGTCAGAAATCAGCCGCGCCGTACTGTTCGGCAAACTGGATACGCTGTTATTTACCTCTCTGGAGAGCG
CCACCGCGTTTTGCAAACTGCGCGGCAACCCCTATGTGGAGCTGGTGCACTGGCTGCATCAGCTGATGCA
GCAACAGAGCGGTGACTTACAGCAGCTTATCCGCCATTTTTCACTGGATGAAGAGGCGCTGACGCGGGAT
ATCGTGGCGGCGCTCGACAGGCTGCCGCGCGGAGCCAGCGCGGTCTCTGACCTGTCTGAACATATCGACA
GCGCGGTGGAGCGCGCCTGGGTTTACGCTTCGTTGAAGTTCGGCGTACAGCAGATCCGTGGCGGCCACCT
GCTTACCGGCCTGCTGAAAACCTTTAACCTTGCCAACCTGCTGAAAGGCATCTCGCCGCAGTTCAGCCGC
GTCAGCGTTGACGTGCTGCTGGAGCAGTTCGATCGGGTATTTGGCGACAGCAAAGAAGCCCGGCAGGTCA
GCGCTGCCCCGCAGACGCCCGGTGGCGAGGTGCCGCAGCAGCAGGGCACGCTGGCGCAGTATGCCCAGGA
TCTGACGGCGCGCGCGCGCGACGGCAAGATCGACCCGGTGGCCGGACGCGACCAGGAGATCCGCCAGATG
GTGGATATTCTGATGCGCCGCCGCCAGAACAACCCGCTACTGACCGGGGAAGCCGGGGTGGGAAAAACGG
CGGTGGTGGAAGGGCTGGCGCTGCGTATCGCCGCCGGCGATGTGCCGGAACCGCTGCAACAGGTGCAGCT
GTGGCTGCTGGATATCGGCATGCTGCAGGCCGGAGCCGGCATGAAGGGCGAATTTGAGGCGCGGCTACAG
GCGCTGATTAACGAAGTGCAGTCCAGCCCGACGCCGATCGTGCTGTTTATTGACGAGATCCACACCCTGG
TCGGCGCGGGCGGCCAGCAGGGCACCGGCGATGCCGCCAACCTGCTGAAACCGGCGCTGGCACGCGGCCA
GCTGCGCACCATCGGCGCTACCACCTGGGCGGAATACAAAAAGTACATTGAGAAAGACCCGGCGCTGACG
CGCCGCTTCCAGACCGTGCAGGTGCACGAGCCGGACGAAGAAAAAGCGCTGCTGATGCTGCGCAGCACCG
TCAGCCCGCTGGAACAGCATCACCGCATCCTGCTGCTGGATGAGGCGGTCGCGGCGGCGGTTAAACTCTC
TCATCGCTATATTCCGGCGCGTCAGCTGCCGGATAAGGCGGTGGCGCTGCTGGACACCGCCTGTGCGCGC
GTCGCCGTCAGCCAGAGCGCCCGGCCGCCGCAGCTGGAAGATTGCCTGCATCGCATTCATGCGCTGGAAA
TTGAACGCGATATCGCCGGGCGCGAAGCGAAAGTCGGCATCGGCGAGGCCGGGCGCGTCACGCAGCTGGA
ACAGCAGCTGGCGGAGCTGGCCGCACAGCGCGACCGGCTGAACGCACGCTGGCAGCAGGAGCGCAGCCTG
GTGGATAGCCTGATTGCCTTGCGGGCGCAGCTTAGCGCAGAGACGGCGGAAAACCCGGCGAACCTGCATC
AGCAGCTGGCCGAACGCCAGCAGCAGCTGCGTGAACTGCAGGGCGACACCCCGCTGCTGTTCGCGGCGGT
GGATGCCAACGTGGTGGCGGCGGTGGTCGCCGACTGGACCGGCATTCCGCTGGGACGGATGGTGAAAAAC
GAAATCGACGCGGTGCTCAAGCTGGCGGATACCCTGAATCAACGGGTGATTGGTCAGCGCCACGGCCTTG
ACCTGATTGCCAAACGGGTGCGCACCTCACGCGCCCGCCTTGACGACCCGAACAAGCCGGTCGGGGTCTT
TATGCTGTGCGGGCCATCCGGGGTGGGTAAAACCGAAACCGCGCTGGCGCTGGCGGAAACCCTGTACGGC
GGCGAACAGAACATCATTACCATCAATATGAGCGAGTTCCAGGAGGCGCATACCGTTTCCACCCTGAAAG
GTGCACCGCCGGGCTACGTTGGCTACGGTGAAGGCGGCGTCCTGACCGAAGCGGTGCGCCGCCGCCCTTA
CAGCGTGGTCCTGCTGGACGAAATTGAAAAAGCGCACCCGGACGTGCATGAAATCTTCTTCCAGGTGTTT
GATAAGGGCTGGATGGAGGACGGAGAAGGGCGGCATATCGATTTCCGCAATACCATTATCATTCTCACTT
CTAACGTCGGTACGCAGCTGATTAGCGCCATGTGTGCCGACCCGGAGCTGATGCCGCAGCCAGAGGACCT
GGCCGGGGCGCTGCGCCCGGCACTGCTGGAGGTGTTTCCCCCGGCGCTACTGGGCCGCCTGCTGGTGGTG
CCTTACTACCCGCTCAGTGATGAGGTGCTGGCCAATATCGTCCGTCTGCAATTACAGCGTATTCAGCGGC
GGCTCCAAGAGAATCACGGTATCATCTCCGACGTGGATGACAGCGTAATTAGCCAGATTGTTCAGCGCTG
TACCGAAGTGGAGTCCGGCGGCCGTATGGTCGACGCCATTCTTACCAATACCCTGTTGCCGCAAATGAGC
CAGATGCTGCTGTCTGCCAGCGCGCGCGACGAACAATTCCGTCGCCTGCGCGTTACGTTACAGCAGGGCG
AATTCCAGTGTCAGTTTGAGGCGTAA