SecReT6
Protein ID: 292489473
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3006
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3113724..3114788 [-]
Producttype VI secretion system core protein
NoteTssG
UniProt IDD4I0P5
KEGG IDeam:EAMY_3006
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-109, Aligned region: 28..332
Protein Sequence: 354 a.a.     [Download]
>gi|292489473|ref|YP_003532361.1| unnamed protein product [Erwinia amylovora CFBP1430]
MTPQPAAQAEKIHRLHRLPPDFWAALCATPWRYDLFQLLRRLDAQGGQRYPLGRAPLPRHEPLRIGQRPS
LAFAPAAIASVSPRENSALHDVSIYSFGLFGPNGPLPIHLTEYARERSDHHQDNSLSAFADLFHHRLTLL
FYRAWADAQPTVALDRAEKRQFERWLASLIGMGQPGQLNQGSVSPHSRLALAGHLTRHARDAEGLQKMLS
HYFQVPVKLVENVPHWQPVDRRDRASLGAGRRKPRLGISAFLGVAVRDVQHKFRLELGPLPMNRYQRFLP
GEPWAQQLRDWVRQYLGIEFVWEVRLILDAADVQGVTLGGPSRLGYSSWLGQPAVPQHRSDLTFSPEPLA
EIAP
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3114788-3113724 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGACACCGCAGCCCGCCGCGCAGGCAGAGAAAATTCACCGCCTGCATCGCCTGCCGCCGGACTTCTGGG
CGGCGCTGTGCGCCACGCCGTGGCGCTACGATCTGTTCCAGCTGCTGCGGCGGCTGGATGCGCAGGGCGG
CCAGCGCTATCCGCTGGGGCGTGCGCCGCTGCCGCGCCACGAGCCGCTGCGCATCGGCCAGCGGCCATCG
CTGGCCTTTGCCCCGGCGGCCATCGCCAGCGTCTCGCCGCGTGAAAACAGCGCGCTGCATGACGTGTCGA
TCTACAGCTTTGGCCTGTTTGGCCCCAACGGCCCGCTGCCGATCCATTTGACGGAGTATGCGCGCGAGCG
CAGCGACCATCATCAGGACAACAGCCTGAGCGCCTTTGCCGATCTGTTCCACCATCGCCTGACGCTGCTG
TTTTACCGCGCCTGGGCCGATGCGCAGCCCACGGTGGCGCTGGACCGGGCGGAAAAACGCCAGTTTGAGC
GCTGGCTCGCCAGCCTGATCGGCATGGGCCAGCCGGGGCAGCTTAACCAGGGTAGCGTTAGCCCGCACTC
ACGGCTGGCGCTGGCCGGGCATCTGACTCGTCACGCACGCGATGCAGAAGGGCTGCAAAAAATGCTCAGT
CACTACTTTCAGGTGCCGGTGAAGCTGGTGGAAAACGTGCCCCACTGGCAGCCGGTTGACCGCCGCGACC
GCGCCAGCCTGGGTGCGGGGCGGCGCAAACCGCGCCTCGGCATATCGGCCTTTCTCGGCGTGGCGGTGCG
CGATGTACAGCACAAATTTCGTCTGGAGCTGGGGCCGCTGCCGATGAACCGCTATCAGCGTTTTCTGCCC
GGCGAACCCTGGGCGCAGCAGCTGCGTGACTGGGTGCGTCAGTACCTGGGCATTGAGTTTGTCTGGGAGG
TGCGGCTGATCCTTGACGCCGCCGACGTGCAGGGCGTTACCCTTGGCGGCCCCTCCCGGCTGGGGTACAG
CAGCTGGCTGGGACAGCCCGCCGTGCCGCAGCACCGCAGCGATCTCACCTTTAGCCCGGAGCCGCTGGCG
GAGATTGCGCCCTGA