SecReT6
Protein ID: 292489474
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3007
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3114785..3116659 [-]
Producttype VI secretion system core protein
NoteTssF
UniProt IDD4I0P6
KEGG IDeam:EAMY_3007
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.80E-209, Aligned region: 6..624
Protein Sequence: 624 a.a.     [Download]
>gi|292489474|ref|YP_003532362.1| unnamed protein product [Erwinia amylovora CFBP1430]
MDSKQLDYYNRELAYLREMGAEFAGRYPKVAGRLAMRGDEVADPYVERLMEGFAFLTSRVQLKMDAEFPR
FSQRLLEMIAPNYLSPTPSMAIAELQPDSRKGDISNGFLVPRGTMMDSQALKQNGVTCSYSTAHDVMLQP
VRIKSVELGGIPANVPLGDLGLSQRGAVSALRIRIACDESVTLAHLNFDSLMFFLSGPDMQALQLLELVM
QHYVGGYCQSVGSNPQRTLLGDNALRQEGFAADQALLPNDLRNFDGYRLLQEYFAFPARFQFISIGQLRP
LLQACDAQAREFDIVLLLDSTNPALERVIDHSHLALHCTPVINLFPKVAQRQKLSDSVHEYHLVVDNIRP
LDYEIFSVQKLYASGERQREEQQFRPFWSTFSDDGGNYGAYFSLRREQRTLSEHAQRFGTRTGYVGSEVF
LSLVDEHNSPWHEDLRYLTAEVMCTSRDLPLLLLQQQGQFVMPDSIPVRQLTLRKGPTPPRPALAEGKIA
WRLVSHLQMNYLSLMDGDNDQGAAALRQMLGLYANLAEAAAARQIDGIRHCQLKPVFRRVPEPGPIVFAR
GIGIELEVDEQAFSGSSPWLLGSVLERVFSRLVAINTFTEMTLTSQQRGEVGYWAPRMGKRTLI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3116659-3114785 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGGACAGTAAGCAGCTCGACTATTACAACCGTGAACTGGCGTATCTGCGCGAAATGGGCGCGGAGTTTG
CCGGGCGTTATCCGAAGGTGGCAGGCCGTCTTGCCATGCGCGGCGACGAGGTCGCCGACCCCTACGTCGA
GCGGCTGATGGAGGGCTTTGCCTTTCTCACCTCCCGCGTGCAGCTGAAAATGGACGCCGAGTTTCCGCGC
TTCTCCCAGCGCCTGCTGGAGATGATTGCGCCGAACTACCTGTCACCAACGCCGTCGATGGCGATTGCCG
AACTGCAGCCGGACAGCCGCAAAGGGGATATCAGCAACGGTTTTCTGGTGCCGCGCGGCACCATGATGGA
CAGCCAGGCGCTGAAGCAGAACGGCGTCACCTGCAGCTACAGCACCGCCCACGATGTGATGCTGCAACCG
GTACGCATCAAAAGCGTGGAACTGGGCGGTATTCCGGCCAATGTCCCACTGGGCGATCTGGGGTTAAGCC
AGCGCGGTGCGGTAAGCGCTCTGCGCATCCGCATCGCCTGTGATGAAAGCGTCACGCTGGCGCATCTTAA
CTTCGACAGCCTGATGTTCTTCCTTAGCGGGCCGGATATGCAGGCGCTGCAGCTGCTGGAGCTGGTAATG
CAGCACTACGTGGGCGGCTACTGCCAGAGCGTGGGCAGCAACCCGCAGCGCACGCTGCTGGGCGATAACG
CGCTCCGGCAGGAAGGATTTGCCGCCGATCAGGCGCTGCTGCCGAACGATCTGCGCAATTTCGATGGTTA
TCGTCTGTTGCAGGAATACTTCGCCTTCCCGGCGCGTTTCCAGTTTATCAGCATCGGTCAGCTGCGCCCG
CTGTTACAGGCATGCGATGCACAGGCGCGTGAATTCGATATCGTACTGCTGCTGGACAGCACCAACCCGG
CGCTGGAGCGGGTCATCGACCACAGCCATCTGGCGCTGCACTGCACCCCGGTAATCAACCTGTTTCCGAA
GGTGGCGCAGCGCCAGAAGCTCAGCGACAGCGTGCACGAATATCATCTGGTGGTGGATAACATCCGCCCG
CTGGACTACGAAATTTTCTCGGTGCAGAAGCTGTATGCCAGCGGCGAACGCCAGCGCGAGGAGCAGCAGT
TCCGCCCGTTCTGGAGCACCTTCAGCGATGATGGCGGCAACTACGGGGCTTACTTCTCGCTACGGCGCGA
ACAGCGCACGCTGTCCGAACATGCGCAACGCTTCGGCACGCGCACCGGCTATGTCGGTTCGGAAGTATTT
CTGTCGCTGGTTGACGAGCACAACTCGCCGTGGCATGAGGATCTGCGCTATCTCACCGCCGAGGTGATGT
GTACCAGCCGCGATCTGCCGCTGCTGCTGCTGCAACAGCAGGGGCAGTTTGTGATGCCTGATTCGATCCC
GGTGCGCCAGCTGACGCTGCGTAAAGGGCCGACGCCACCGCGTCCGGCGCTGGCGGAGGGGAAAATCGCC
TGGCGGCTGGTCAGTCATTTGCAAATGAACTACCTCAGCCTGATGGACGGTGATAATGACCAGGGGGCGG
CGGCGCTGCGCCAGATGCTTGGGCTGTATGCCAACCTGGCCGAAGCCGCAGCGGCACGCCAGATCGACGG
CATCCGCCACTGCCAGCTGAAACCGGTGTTCCGGCGCGTACCGGAGCCAGGCCCGATTGTCTTTGCCCGT
GGCATCGGCATTGAGCTGGAGGTGGACGAGCAGGCATTTTCCGGCAGCAGCCCGTGGCTGCTTGGCAGCG
TGCTGGAGCGGGTATTCTCGCGGCTGGTGGCGATCAACACCTTCACCGAAATGACGCTGACCAGCCAGCA
GCGCGGCGAGGTCGGCTACTGGGCGCCGCGCATGGGCAAAAGGACGCTGATATGA