SecReT6
Protein ID: 292489475
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3008
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3116678..3117244 [-]
Producttype VI secretion system core protein
NoteTssE
UniProt IDD4I0P7
KEGG IDeam:EAMY_3008
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.70E-19, Aligned region: 57..167
Protein Sequence: 188 a.a.     [Download]
>gi|292489475|ref|YP_003532363.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSQHSNEGHKLLHGGYRQRRQQEGLNVRDKMQPSLLDRLTDNAPDNPREAAHSTLISHSALRRNVLRDLQ
WLFNTINNEAQQDLSPFPHVQRSTLNFGISPLAGQRMSDIEWLDIQRKLSAAILNFEPRILPAGLQVRCV
SDTRSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDVDLENGHFALRDIG
 
Nucleotide Sequence: 567 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3117244-3116678 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAGCCAGCACAGCAACGAGGGGCATAAGCTGCTGCACGGCGGTTACCGCCAGCGCCGCCAGCAGGAAG
GGCTGAACGTGCGCGACAAAATGCAGCCATCGCTGCTCGACCGCTTAACCGATAACGCGCCGGATAACCC
GCGTGAAGCGGCGCACAGCACCCTGATTTCACACAGCGCGCTGCGGCGTAACGTGCTGCGCGACCTGCAA
TGGTTGTTTAACACCATTAACAACGAAGCGCAGCAGGATCTGTCACCGTTTCCCCATGTGCAACGCTCGA
CGCTGAACTTCGGCATATCGCCGCTGGCGGGGCAGCGCATGTCGGATATTGAATGGCTGGATATCCAGCG
CAAGCTAAGCGCGGCGATCCTTAACTTCGAACCGCGCATTCTGCCCGCCGGGTTACAGGTGCGCTGCGTG
TCGGACACCCGCTCGCTTGACCTGCACAACGTGCTGTCGATAGAGATCAAAGGCCGTCTGTGGTGCGTGC
CGTACCCGCTGGAATTTCTGTTTCGTACCGATGTGGATCTGGAAAACGGCCACTTTGCGCTGCGCGATAT
CGGTTAA