SecReT6
Protein ID: 292489476
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3009
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3117241..3118062 [-]
Producttype VI secretion system-associated protein
NoteTagJ
UniProt IDD4I0P8
KEGG IDeam:EAMY_3009
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.30E-39, Aligned region: 143..266
TPR_19 [PF14559], Evalue: 0.00091, Aligned region: 8..68
TPR_19 [PF14559], Evalue: 0.00091, Aligned region: 101..125
Protein Sequence: 273 a.a.     [Download]
>gi|292489476|ref|YP_003532364.1| unnamed protein product [Erwinia amylovora CFBP1430]
MHSLQYLMDGQSLAETLARLESQIKRQPGDADLRASFVQLLCLAGNWSRAQTQLKSWLALKPQAQPTVTL
LEQAINGERQRAAVFAGEATPRMPGAAWNWAEQLLAALAADAGGDNAEAQRLRAAAIDAAQLNPGQLTHQ
GEQHAFAWLADGDGRLGPVCELIANGQYSWLPFGAISEMRFQAPVSVTDLVWRHTLVRLVDGSEQVCQIP
VRYPFGEQADDRYRLATLTEWQPLAGDDQQFSGHGQKCWFSADGEFPLLGMETLAFSDAEPAL
 
Nucleotide Sequence: 822 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3118062-3117241 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGCACTCTCTACAATATCTGATGGACGGCCAGTCGCTGGCCGAAACCCTGGCCCGGCTGGAAAGCCAGA
TTAAGCGCCAGCCCGGCGATGCCGATTTACGTGCCAGCTTCGTCCAGCTGCTGTGCCTGGCGGGCAACTG
GAGCCGGGCGCAGACGCAGCTGAAATCCTGGCTGGCGTTGAAGCCGCAGGCACAGCCGACGGTCACGCTG
CTGGAGCAGGCAATTAACGGTGAACGCCAGCGGGCGGCGGTATTCGCCGGTGAAGCGACGCCACGGATGC
CGGGCGCGGCCTGGAACTGGGCAGAGCAACTGCTGGCCGCGCTGGCGGCCGATGCCGGGGGTGACAATGC
CGAGGCGCAACGGCTGCGCGCTGCCGCTATAGATGCGGCGCAGCTCAATCCCGGGCAGTTGACGCACCAG
GGCGAGCAGCACGCTTTTGCCTGGCTGGCCGACGGTGACGGACGGCTCGGCCCCGTCTGCGAACTGATCG
CCAACGGCCAGTACAGCTGGCTGCCGTTCGGCGCCATCAGCGAAATGCGCTTCCAGGCTCCGGTCAGCGT
CACCGATCTGGTGTGGCGGCATACGCTGGTCAGGCTGGTGGACGGCAGCGAACAGGTGTGCCAGATCCCG
GTACGCTATCCGTTTGGCGAACAGGCCGACGACCGCTACCGTCTGGCCACGCTGACCGAATGGCAGCCGC
TGGCGGGCGACGACCAGCAGTTCAGCGGCCACGGTCAGAAATGCTGGTTCAGCGCCGATGGCGAATTCCC
GCTGCTGGGCATGGAGACGCTGGCGTTTAGCGATGCAGAGCCAGCGTTATGA