SecReT6
Protein ID: 292489479
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3012
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3119889..3121730 [-]
Producttype VI secretion system core protein
NoteFha
UniProt IDD4I0Q1
KEGG IDeam:EAMY_3012
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 2.40E-08, Aligned region: 27..94
UreE_N [PF02814], Evalue: 0.0023, Aligned region: 30..49
UreE_N [PF02814], Evalue: 0.0023, Aligned region: 78..99
Protein Sequence: 613 a.a.     [Download]
>gi|292489479|ref|YP_003532367.1| unnamed protein product [Erwinia amylovora CFBP1430]
MRFTIITTKQGQQPPQGSCDFLPPGGTIGRGADNNLVLPDDDRTISRLQAIVHINATGECHITNRGNVTR
VHLNDIPLERGRQVELQDGDIIGIDDYRLQVSELSAAAQPIIQPVPAPAATRPQPAAAPVAPAPAVKAAP
AAIPSEIWDSLAQEFSISDNLSSRSKAKAQSQANPLTAPAAAERNPADPLAQLAQSSDPLNLERRDRTPD
SLFNQDPLFKQDSIFDDSTPSTLFQPTGAKNSVANGGRENEQDPLALFGTGAAPQVDRDDPLGLMMGSAV
PLTPPEDKPQQISGQPNIPPTPEPVPPVPGEKTPSPADELPLPDCDFSLFGDAKTQQSDEASSPLFDVPP
PAPAAAPSSASGDYGGITLPTPQARARASTPPPKGRLRIDPVANITAHSSDKGDSGEVLEGDLMAALIGG
MGLQDLQPTPRFDHHAMQELGQMLSMFSQGTVALLSSRSILKRGVKAEMTVILDEANNPFKLLPSGKSVL
MQMFGSRMPGFMPPKQSVRDALVDLQAHQLGMIAGIRALIASMLQSFNPQQLEEEARQDGAISRLSLPGS
RKAALWDHFSKRYSETAGEIEDDFHTLFGEAFLHAYDMEVNQYKDSQIRSEER
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3121730-3119889 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGCGATTTACGATTATAACGACTAAACAGGGCCAGCAGCCGCCGCAGGGCAGCTGCGATTTTCTGCCGC
CCGGCGGCACCATTGGCCGTGGAGCCGATAACAATCTGGTACTGCCGGATGACGACCGCACCATTTCGCG
CCTGCAGGCTATTGTGCATATCAACGCCACGGGCGAATGCCATATCACCAATCGCGGCAATGTCACGCGC
GTCCACCTGAATGATATTCCGCTTGAGCGTGGCCGCCAGGTGGAGCTACAGGATGGCGATATCATCGGCA
TCGATGACTATCGCCTGCAGGTCAGCGAACTTAGCGCAGCGGCGCAGCCGATCATTCAGCCGGTGCCAGC
ACCCGCAGCTACGCGCCCGCAGCCGGCCGCCGCGCCTGTCGCTCCCGCTCCGGCGGTCAAGGCTGCGCCA
GCGGCGATCCCCAGCGAAATCTGGGACAGCCTGGCCCAGGAGTTCTCGATCTCCGATAACCTCTCCAGCC
GCAGCAAAGCGAAAGCGCAAAGCCAGGCTAACCCGCTGACCGCCCCGGCCGCCGCCGAGCGTAATCCGGC
CGATCCGCTGGCCCAGCTGGCGCAAAGCAGCGATCCGTTAAACCTTGAACGCCGCGATCGGACCCCCGAC
AGCCTGTTTAACCAGGATCCGCTGTTTAAACAGGACAGCATCTTTGATGACAGCACCCCCAGCACACTGT
TCCAGCCGACGGGGGCGAAAAACAGCGTTGCCAATGGCGGACGTGAAAACGAGCAGGACCCGCTGGCGCT
GTTCGGCACGGGCGCAGCGCCACAGGTCGACCGCGACGATCCGCTTGGCCTGATGATGGGCAGCGCGGTG
CCGCTGACGCCGCCAGAGGATAAGCCGCAGCAGATCTCCGGGCAGCCGAACATCCCGCCAACGCCAGAAC
CCGTGCCGCCTGTACCCGGCGAAAAAACGCCCTCTCCGGCGGATGAACTGCCGCTGCCGGACTGCGATTT
CAGCCTGTTTGGCGATGCCAAAACCCAGCAGTCAGACGAGGCCAGTTCGCCGCTGTTTGACGTGCCGCCG
CCAGCTCCGGCTGCGGCTCCGTCCTCCGCCAGCGGCGACTATGGTGGTATCACGCTGCCCACGCCGCAGG
CGCGCGCGCGCGCCAGTACGCCACCACCAAAAGGGCGTCTGCGCATTGACCCGGTCGCCAACATCACGGC
GCACAGCAGCGATAAAGGCGACAGCGGTGAAGTGCTGGAGGGCGATCTGATGGCGGCGCTGATCGGCGGG
ATGGGCCTGCAGGATCTGCAACCTACGCCGCGCTTTGACCATCATGCGATGCAGGAACTGGGGCAGATGC
TCAGTATGTTCTCGCAGGGCACGGTGGCGCTGCTCTCTTCGCGATCGATCCTCAAACGCGGCGTAAAAGC
CGAAATGACGGTGATCCTCGACGAGGCCAACAACCCGTTTAAGCTGCTGCCGTCGGGCAAATCGGTACTG
ATGCAGATGTTTGGCAGCCGGATGCCGGGTTTTATGCCGCCGAAGCAGTCGGTGCGCGATGCGCTGGTCG
ATTTGCAGGCGCACCAGCTGGGGATGATCGCCGGCATCCGGGCGCTGATCGCTTCTATGCTGCAATCGTT
TAACCCGCAACAGCTGGAGGAGGAAGCGCGCCAGGATGGTGCCATCTCGCGCCTGTCGCTGCCGGGCAGC
CGCAAGGCCGCGCTGTGGGACCACTTCAGCAAACGCTATAGCGAAACCGCCGGCGAGATTGAAGACGACT
TCCACACCCTGTTTGGCGAAGCTTTCCTTCATGCTTACGATATGGAAGTCAACCAGTACAAAGACTCACA
GATCAGATCGGAAGAAAGATGA