SecReT6
Protein ID: 292489486
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3019
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3123799..3124281 [-]
Producttype VI secretion system effector protein hcp
NoteTssD
UniProt IDD4I0Q8
KEGG IDeam:EAMY_3019
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|292489486|ref|YP_003532374.1| unnamed protein product [Erwinia amylovora CFBP1430]
MAIDMYLKVDGVTGESKDSNHTGWIDVSSFSWGATQPGNMSVGGGGGAGKVNFNDLHINAKIDKAVTALL
KNCASGKHVGKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSDGDDTLGVTYAFQAAKVKQQYWEQST
SGGKGAESSAGWNIKENKEA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3124281-3123799 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGGCTATTGATATGTATTTGAAAGTTGACGGTGTAACCGGTGAATCTAAAGATTCTAACCACACCGGTT
GGATCGACGTGTCTTCTTTCTCCTGGGGCGCTACCCAGCCGGGCAATATGTCGGTAGGCGGCGGCGGCGG
TGCCGGTAAAGTGAACTTTAACGATCTGCACATCAATGCAAAAATTGATAAAGCGGTCACCGCGCTGCTG
AAAAACTGCGCCAGCGGTAAGCACGTAGGTAAAGTAGAAGTTTCCGTATGTAAAGCGGGCGGCACTCAGA
TTGAGTACACGCGTATTACTCTGGAAGACGTGCTGGTCACCAACGTGCAGTTCGTTGGTTCCGACGGTGA
CGATACTCTGGGCGTAACCTACGCATTCCAGGCTGCCAAAGTGAAACAGCAGTACTGGGAGCAGAGCACC
TCCGGCGGTAAAGGCGCAGAAAGCAGCGCTGGCTGGAATATTAAAGAGAATAAAGAAGCGTAA