SecReT6
Protein ID: 292489487
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3020
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3124559..3126058 [-]
Producttype VI secretion system core protein
NoteTssC
UniProt IDD4I0Q9
KEGG IDeam:EAMY_3020
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 9.70E-196, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|292489487|ref|YP_003532375.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSNQFQQSGDLQQQAYSEDAFSALLNKEFRPKSDQARAAVESAVKTLAQQALENTVTVSNDAYRTIQALI
AEIDEKLSLQVNQIIHHEDFQQLEGAWRGLSYLVNNTETDEMLKIRFMSISKQELGRTLKRYKGVSWDQS
PIFKKIYEEEYGQFGGEPFGCLVGDYYFDHSPQDVELLSEMARIGSAAHCPFITGTAPGVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGANHGNYTWTN
AAYAMAANINRSFKDFGWCTSIRGVESGGAVENLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLASAEVQVQEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNDA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3126058-3124559 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAGCAATCAATTCCAACAGTCTGGCGACCTGCAACAGCAGGCCTACAGCGAGGACGCGTTCAGCGCGC
TGCTGAATAAAGAGTTCCGCCCGAAAAGCGACCAGGCGCGCGCCGCGGTGGAAAGTGCGGTGAAAACCCT
GGCGCAGCAGGCGCTGGAAAATACCGTTACCGTATCCAACGATGCCTACCGCACCATTCAGGCGCTGATC
GCCGAGATCGACGAGAAGCTCTCCCTGCAGGTCAACCAGATTATCCACCATGAAGACTTCCAGCAGCTGG
AAGGCGCGTGGCGCGGCCTGAGCTATCTGGTCAACAATACCGAAACCGATGAGATGCTGAAAATCCGCTT
TATGAGCATCTCTAAACAGGAGCTGGGCCGCACGCTGAAGCGCTACAAAGGCGTTAGCTGGGATCAAAGC
CCCATCTTCAAGAAGATCTATGAGGAAGAGTACGGCCAGTTTGGCGGCGAACCCTTTGGTTGCCTGGTGG
GCGACTACTACTTTGACCACAGCCCGCAGGACGTGGAGCTGCTTAGCGAAATGGCGCGTATCGGTTCTGC
CGCCCACTGTCCGTTTATCACCGGCACCGCGCCGGGCGTGATGCAGATGGAGTCCTGGCAGGAGCTGGCC
AACCCGCGCGACCTGACCAAAATCTTCCAGAACACCGAATATGCCGCGTGGCGCAGTCTGCGCGAGTCGG
AAGATGCACGCTATCTTGGCCTGGTGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCATTCGCACCAA
CCCGGTCGACAGCTTCGACTTCGAAGAGCAGACCGACGGCGCTAACCACGGTAACTACACCTGGACCAAC
GCCGCCTACGCGATGGCCGCCAATATCAACCGTTCGTTTAAGGATTTTGGCTGGTGTACCTCAATTCGCG
GCGTCGAGTCCGGCGGGGCGGTGGAAAATCTGCCGTGCCACACCTTCCCGAGCGACGACGGCGGCGTGGA
TATGAAATGCCCGACCGAAATCGCCATCAGCGATCGTCGTGAAGCCGAGCTGGCGAAAAACGGTTTTATG
CCGCTGGTGCACCGCAAAAACTCCGACTTTGCCGCCTTTATCGGCGCACAGTCGCTGCAGAAACCGGCGG
AGTACCACGATGCCGACGCCACTGCCAATGCGCGTCTGGCGGCGCGCCTGCCGTACCTGTTCGCCTGCTG
CCGCTTTGCCCACTATCTGAAGTGCATCGTGCGCGACAAAATTGGCTCCTTCCGCGAGCGCGACGAGATG
GAGCGCTGGCTGAACGACTGGGTGATGAACTACGTTGACGGTGACCCGGCTAACTCCTCACAGGAAACCA
AATCGCGTAAGCCGCTGGCTTCTGCCGAGGTGCAGGTGCAGGAGATTGAAGATAACCCGGGCTACTACGC
CGCCAAGTTCTTTCTGCGTCCGCATTACCAGCTGGAGGGCCTGACCGTATCACTGCGTCTGGTTTCTAAA
CTGCCGTCGCTGAAATCGAACGACGCGTGA