SecReT6
Protein ID: 292489488
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3021
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3126062..3126598 [-]
Producttype VI secretion system core protein
NoteTssB
UniProt IDD4I0R0
KEGG IDeam:EAMY_3021
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.10E-59, Aligned region: 12..162
Protein Sequence: 178 a.a.     [Download]
>gi|292489488|ref|YP_003532376.1| type VI secretion system core protein [Erwinia amylovora CFBP1430] [TssB]
MAVSKSSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMSDLVGKPLEAQPGIDERKFLEIDVDN
FDERMKALKPRVAFQAENTLTGEGRLNIDLTFNSMEDFSPDAVARKVEPLNQLLDARTQLANLLTYMDGK
NGAEELIGKILQDPTLLQSLSHLPKADDKAADDHGNKE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3126598-3126062 Erwinia amylovora CFBP1430, complete sequence [TssB]
ATGGCAGTCAGTAAATCCAGTGGGCAGAAATTCATTGCCCGTAACCGCGCGCCACGCGTGCAGATTGAGT
ACGACGTGGAAATTTATGGCGCGGAACGCAAAATCCAGCTGCCCTTCGTGATGGGCGTGATGTCCGACCT
GGTCGGTAAACCGCTGGAAGCGCAGCCGGGCATCGATGAACGTAAGTTCCTTGAAATCGACGTCGATAAC
TTTGATGAACGCATGAAGGCGCTGAAGCCTCGTGTGGCATTCCAGGCAGAAAACACCCTGACCGGCGAAG
GGCGTCTTAACATCGACCTGACCTTTAACAGCATGGAAGACTTCTCGCCGGATGCGGTAGCGCGCAAGGT
GGAACCGCTTAATCAGCTGCTGGATGCCCGTACCCAGCTGGCTAACCTGCTGACCTACATGGATGGCAAA
AACGGTGCGGAAGAGCTGATCGGCAAAATCCTGCAGGACCCGACGCTGCTGCAATCACTTAGCCATCTGC
CGAAAGCTGACGACAAGGCAGCCGACGACCACGGCAACAAGGAGTAA