SecReT6
Protein ID: 292489489
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3022
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3126661..3127680 [-]
Producttype VI secretion system core protein
NoteTssA
UniProt IDD4I0R1
KEGG IDeam:EAMY_3022
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.40E-18, Aligned region: 52..111
ImpA-rel_N [PF06812], Evalue: 2.40E-18, Aligned region: 184..201
Protein Sequence: 339 a.a.     [Download]
>gi|292489489|ref|YP_003532377.1| unnamed protein product [Erwinia amylovora CFBP1430]
MNLETLLAPVTPERPCGENLEYDADYMAMEQASAGKAEQQFGDTIIPAEPADWNKVERLALGLLGRSKDL
RVMLALTRAWTQLKGLSGYADGLHLIQQALLLYWQPLWPSLEEDGAEDPFYRLNALAALGDKSALTSALR
QAPLLRYATDEISLRDACALLDGSKTECPGYPGGRTRLQDELIRGGLPGIDAVLKISERLLTIRETLTEQ
LGAAALPEMEQLLKTVNTVAAACQATDLSTLIPRVETAASSATPPPAAAPAAQQHADWRSVQLGSRSDAQ
LMLEKVKQYFSQHEPSHPAPLMIERVQRMIELDFMDIIRDLAPDGVHQLETIFGRRDHS
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3127680-3126661 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAATCTTGAAACGCTGCTGGCCCCGGTCACGCCTGAACGCCCCTGTGGGGAAAATCTCGAATATGACG
CCGACTACATGGCGATGGAACAGGCCAGCGCCGGCAAAGCCGAGCAGCAGTTTGGCGACACCATCATTCC
GGCAGAACCCGCAGACTGGAACAAAGTCGAGCGGCTGGCGCTGGGACTGCTGGGGCGCAGCAAAGATCTG
CGCGTGATGCTGGCGCTGACCCGCGCCTGGACCCAGCTAAAAGGATTGAGCGGTTACGCCGATGGCCTGC
ATCTTATCCAGCAGGCGCTGCTGCTTTACTGGCAGCCGCTGTGGCCGTCACTGGAAGAGGATGGCGCAGA
GGATCCGTTTTACCGTCTTAATGCGCTGGCGGCGCTGGGGGACAAATCGGCGCTGACCAGCGCGCTGCGC
CAGGCGCCGCTGCTGCGCTATGCCACCGATGAAATCAGTCTGCGTGACGCCTGTGCACTGCTCGACGGCA
GCAAAACCGAATGCCCCGGCTACCCCGGCGGCCGCACCCGTTTGCAGGATGAGCTGATAAGGGGGGGGCT
GCCCGGCATTGATGCTGTTCTCAAAATAAGTGAGCGGTTACTGACAATTCGCGAAACGCTGACTGAGCAG
CTGGGCGCTGCGGCGCTGCCGGAAATGGAGCAGCTGCTGAAAACCGTCAATACCGTGGCCGCCGCCTGTC
AGGCCACCGACCTCAGCACCCTGATCCCCCGGGTGGAAACCGCCGCCAGCAGCGCAACGCCGCCGCCAGC
CGCCGCGCCAGCGGCACAGCAGCACGCCGACTGGCGCAGCGTACAGCTTGGCTCGCGCAGCGATGCGCAG
CTGATGCTGGAAAAGGTGAAACAGTACTTCAGCCAGCACGAGCCAAGCCACCCGGCTCCGCTGATGATCG
AGCGGGTACAACGCATGATAGAGCTGGACTTTATGGACATTATCCGCGACCTCGCCCCGGACGGCGTGCA
CCAGCTGGAAACGATTTTCGGGCGTCGCGACCACTCATAG