SecReT6
Protein ID: 292489492
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3025
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3132061..3133302 [-]
Producttype VI secretion system core protein
NoteTssL
UniProt IDD4I0R4
KEGG IDeam:EAMY_3025
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-71, Aligned region: 21..226
DUF2077 [PF09850], Evalue: 5.50E-71, Aligned region: 353..390
OmpA [PF00691], Evalue: 4.60E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|292489492|ref|YP_003532380.1| unnamed protein product [Erwinia amylovora CFBP1430]
MKQQRHSDAAQTGMNGANGHNPLVAAANPLLNAIPQIRHSVAHPDPAGLRQRLVDEIRQFEMHCQRAGLP
WEVIIGARYCLCTALDEAAALTPWGGRGVWPGNGLLVTFHNETWGGEKFFQLLARLSQTPREQIALLELI
NFCLQLGFEGRYRVMDNGRSQLETIRQRLLQMIRSVRGGYAPPLSAHPEDHPVTRQLWRPLVPLWACSAV
VGFLACLLYILLNWRLGDYTSPVLASIYQTTLPEVSIHNPAPPPPAAVNLKTFLRPEIEQGLVAVRDEAD
RSVVTLKGDGLFTSASTEVRGRYAEVLDRVAAAMNSVSGRILVVGYSDNVPIRSARFASNYELSLARAQS
VSEQLQQHLTQPQRVKAEGRGESNPLAPNNSAGNRARNRRVEITLLVSPGSTRAELNDMAQGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3133302-3132061 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAAACAGCAAAGACATTCAGATGCCGCCCAGACGGGTATGAACGGTGCCAACGGTCATAATCCCCTGG
TCGCCGCCGCCAACCCGTTGCTGAACGCCATTCCCCAGATCCGCCATTCGGTCGCCCATCCCGATCCTGC
CGGACTGCGTCAGCGGCTGGTCGACGAAATTCGCCAGTTTGAAATGCATTGCCAGCGTGCCGGGCTGCCC
TGGGAAGTGATTATCGGCGCACGTTACTGCCTGTGTACCGCGCTGGATGAAGCCGCTGCGCTTACTCCCT
GGGGTGGGCGCGGCGTCTGGCCCGGCAACGGGCTGCTGGTTACCTTTCATAATGAAACCTGGGGCGGCGA
AAAATTTTTCCAGCTGCTGGCGCGTCTGTCGCAGACGCCACGTGAGCAGATCGCCCTGCTGGAGCTGATT
AATTTCTGCCTGCAGCTGGGCTTTGAAGGGCGCTACCGGGTGATGGATAACGGGCGCTCCCAGCTGGAGA
CCATCAGGCAGCGGCTGTTGCAGATGATCCGCTCGGTGCGCGGTGGCTATGCACCGCCGCTGTCGGCACA
TCCCGAAGACCATCCGGTAACGCGACAACTGTGGCGGCCGCTGGTGCCGCTGTGGGCCTGTAGCGCCGTG
GTGGGCTTCCTCGCCTGTCTGCTCTATATCCTGCTTAACTGGCGGCTGGGTGATTATACCAGCCCGGTGC
TGGCCTCGATTTACCAGACCACGCTACCGGAAGTGAGCATTCACAATCCGGCTCCGCCGCCGCCGGCAGC
GGTTAATCTGAAAACCTTTCTGCGGCCCGAAATCGAACAGGGGCTGGTGGCGGTGCGCGACGAGGCCGAC
CGCAGCGTAGTGACGCTAAAAGGTGACGGCCTGTTTACCTCCGCCTCCACCGAAGTCCGTGGCCGCTACG
CCGAGGTGCTGGATCGCGTTGCCGCCGCGATGAACAGCGTGAGCGGCCGCATTCTGGTGGTGGGCTACAG
CGATAATGTACCGATCCGCAGCGCGCGCTTTGCCTCCAACTACGAGCTATCTCTGGCGCGTGCGCAGTCG
GTTTCCGAGCAATTGCAGCAGCATCTTACACAGCCGCAGCGGGTGAAAGCGGAAGGGCGGGGCGAAAGCA
ACCCGCTCGCGCCGAACAACAGCGCCGGGAACCGCGCCCGCAACCGACGCGTAGAGATCACCCTGCTGGT
TTCGCCGGGCAGCACCCGGGCCGAGCTGAACGACATGGCGCAAGGAAATTAA