SecReT6
Protein ID: 292489493
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3026
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3133320..3134663 [-]
Producttype VI secretion system core protein
NoteTssK
UniProt IDD4I0R5
KEGG IDeam:EAMY_3026
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-142, Aligned region: 19..443
Protein Sequence: 447 a.a.     [Download]
>gi|292489493|ref|YP_003532381.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSKAEKVVWTEGMFLRPHHFQQSENYLQSTLRDWGQAQRPWLWGLHDIEFDESMLRQGKVALLSASGLLP
DGTVFSFRNGQDAPAPLLIPDNLTQGKVVLALPARRGGREEVIFSEAADSLARFISFEREVDDVNAMAVG
QAAVQFGRLRLRLMLESELSAEWTAIGVARISEKRSDHQLRLDASYIPPMLNAINQSQLMEYIGDIHALL
AQRSQQIGQRLQQPGRFNTADMVDFMLLTLINQQLGHISHLKSLPLLHPETLFHGWLTFAAELTSWMPSR
TPDGALPTYQHDDLAGCFSQLLLLLRQGLSQVMEENALQLPLTERSHGLNVATVPESSMVREFGFVLAVR
ANVPADAIQTHFPAQMKVAPVTKIRDLVQLQLPGIMLRAMPAAPPQIPWHAGYNYFQLDKGSELWQEMEK
SGTFALHLAGEFPGLEMEFWAIRSHAV
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3134663-3133320 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAGCAAGGCAGAAAAAGTAGTCTGGACCGAAGGAATGTTTCTGCGTCCGCATCATTTCCAGCAGAGCG
AAAACTACCTGCAGAGCACGCTGCGCGACTGGGGACAGGCGCAGCGCCCGTGGCTGTGGGGCCTGCACGA
CATTGAATTTGATGAATCGATGCTGCGCCAGGGCAAAGTTGCGCTGCTCTCGGCCAGCGGCCTGCTGCCG
GACGGCACGGTATTTTCCTTCCGCAATGGGCAAGATGCCCCGGCGCCGCTGTTAATCCCTGATAACCTGA
CTCAGGGCAAAGTGGTACTGGCGCTGCCGGCGCGGCGCGGCGGCCGTGAAGAGGTGATCTTCAGCGAAGC
GGCCGATTCGCTGGCGCGCTTTATCAGCTTCGAGCGCGAAGTCGATGATGTTAACGCCATGGCGGTCGGT
CAGGCGGCGGTACAGTTTGGCCGTTTACGTCTGCGGCTGATGCTGGAAAGTGAACTCAGCGCCGAATGGA
CCGCCATCGGCGTGGCGCGTATCAGCGAAAAGCGTAGTGACCACCAACTACGCCTTGACGCCAGCTATAT
TCCACCGATGCTTAATGCCATCAACCAGTCACAGCTGATGGAATACATCGGTGATATCCACGCCCTGCTG
GCGCAGCGCAGCCAGCAGATTGGCCAGCGCTTACAGCAGCCCGGACGCTTTAACACCGCCGATATGGTGG
ACTTTATGCTGCTGACGCTGATTAATCAGCAGCTGGGGCATATCAGCCACCTGAAAAGCTTGCCGCTGCT
CCATCCTGAAACGCTGTTCCACGGCTGGCTCACCTTTGCGGCTGAACTGACCAGCTGGATGCCGTCGCGC
ACCCCGGACGGCGCACTCCCGACCTACCAACACGACGATCTGGCTGGCTGTTTCAGTCAGCTGCTGCTGT
TGCTGCGTCAGGGGCTGTCGCAGGTGATGGAAGAGAATGCGCTTCAGCTGCCGCTGACCGAGCGCTCTCA
CGGGCTGAACGTGGCGACCGTGCCGGAGTCCTCAATGGTGCGCGAGTTTGGCTTTGTGCTGGCGGTGCGT
GCCAACGTGCCGGCCGACGCGATACAAACCCACTTCCCGGCGCAGATGAAGGTGGCTCCGGTGACGAAAA
TCCGCGATCTGGTTCAGCTGCAGCTGCCGGGCATTATGCTGCGCGCCATGCCCGCCGCGCCGCCGCAGAT
CCCGTGGCACGCCGGCTACAACTATTTTCAGCTCGATAAGGGCAGCGAACTGTGGCAGGAAATGGAAAAG
TCCGGCACCTTCGCGCTGCACCTGGCCGGTGAATTCCCGGGGCTGGAGATGGAGTTCTGGGCAATCCGCA
GTCACGCAGTCTGA