SecReT6
Protein ID: 292489494
SecReT6 ID386
T6SS typei3
Gene symbol-
Locus tagEAMY_3027
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3134683..3135195 [-]
Producttype VI secretion system core protein
NoteTssJ
UniProt IDD4I0R6
KEGG IDeam:EAMY_3027
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.30E-29, Aligned region: 20..137
Protein Sequence: 170 a.a.     [Download]
>gi|292489494|ref|YP_003532382.1| unnamed protein product [Erwinia amylovora CFBP1430]
MHRLSIFRLVTQAFLLAAFTLLAGCVSTSRSVPAQYSLVFQAHPQINNSAPLKVRVLLLKSDADLMAADF
YSLQTNPQGVLGQNLLNSEQFFLMPGQTDKKLAGQSSPEARYIGIMAEYQMLDGKKWRISLPVPLPAERH
FYQFWQGDADNLRADIIADINGVRVVNARD
 
Nucleotide Sequence: 513 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3135195-3134683 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGCACAGACTTTCGATTTTTCGCCTGGTGACTCAGGCGTTTTTGCTGGCAGCCTTTACCCTGCTGGCAG
GTTGTGTTTCCACTTCACGCAGCGTCCCCGCGCAGTACAGCCTGGTCTTTCAGGCACATCCTCAGATCAA
CAACTCGGCTCCGCTGAAAGTACGGGTGCTGCTGCTGAAGTCGGATGCGGATTTAATGGCGGCCGATTTC
TATTCGCTGCAAACCAATCCGCAGGGCGTGCTGGGGCAAAACCTGTTGAACAGCGAGCAGTTTTTCCTGA
TGCCGGGGCAAACTGACAAAAAACTGGCCGGGCAGAGCAGCCCGGAGGCGCGGTATATCGGCATTATGGC
GGAATATCAAATGCTTGATGGCAAAAAGTGGCGTATTTCACTGCCGGTTCCTCTCCCCGCAGAACGCCAT
TTTTATCAGTTCTGGCAGGGGGATGCGGATAATCTGCGTGCCGACATCATCGCCGATATCAACGGTGTCC
GTGTTGTTAATGCCCGCGATTAG