SecReT6
Protein ID: 292489664
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3201
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3291637..3293037 [-]
Producttype VI secretion system core protein
NoteTssA
UniProt IDD4I208
KEGG IDeam:EAMY_3201
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 9.20E-45, Aligned region: 111..131
DUF3702 [PF12486], Evalue: 9.20E-45, Aligned region: 315..452
ImpA-rel_N [PF06812], Evalue: 9.70E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 9.70E-20, Aligned region: 361..382
Protein Sequence: 466 a.a.     [Download]
>gi|292489664|ref|YP_003532554.1| unnamed protein product [Erwinia amylovora CFBP1430]
MTHFSERYLKTGADPRTLPDYAALRDELSKLAHPARPDVNWHYAEKLCLALFGHNGVELQTAAWYTLCRT
QLAGLFGLNEGLAILDALISHQWSGLWPQPVHARMEILSSLSQRIQQLMRRLPLNYSDLSQLYRAEQLLS
SMGSALQRLELKHLCQFDPLRTLMHNSAVRLENSDVASGHTADNQPGFKLSIDATPKAAISVGGLSGIPG
SAKSESPNTVKWVCVAQPAYQPNVGVVTEMPSSTKPWKPFATGMVTMLVISATTVWGWNAFHRPDPLQTQ
LAASLAPLPSVLSSEQLEGLRQQAPLPETIIKNTRQQLARLEQLPPGWTSQYGHQLVQQALMMWPEQAKG
LAREWQQQLNAAALPTENLNGWHEGMSQLQQLSHKLNGLDGQKGKYMTVSELKSVVYSATQAFNRSIPAE
EQLRRYAVNPSDIQRRQVETVLQQLQKRYALFRLGQQKETTILATE
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3293037-3291637 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGACGCACTTTTCTGAACGTTATCTGAAAACTGGCGCCGACCCGCGCACGCTGCCGGATTATGCCGCTC
TGCGCGATGAATTGTCTAAACTGGCTCACCCGGCTCGGCCCGATGTTAACTGGCACTATGCGGAAAAACT
CTGTCTCGCGTTGTTCGGGCACAACGGCGTGGAGCTTCAGACTGCAGCCTGGTACACGCTTTGCCGCACT
CAGCTTGCCGGGCTGTTCGGCTTAAATGAAGGGCTGGCAATCCTTGATGCACTGATTTCTCACCAGTGGT
CAGGATTGTGGCCGCAGCCGGTGCATGCACGGATGGAGATTCTCAGCAGTCTTAGCCAGCGCATTCAGCA
ACTGATGCGCAGGCTACCTTTAAACTACAGCGACCTCAGCCAGCTTTATCGGGCGGAGCAGCTACTCAGT
AGTATGGGCTCAGCGTTACAGCGTTTGGAACTAAAGCATCTATGCCAGTTTGACCCCCTGCGTACCTTAA
TGCATAACAGTGCCGTTCGGCTGGAAAACAGTGATGTTGCTTCAGGTCATACTGCAGACAATCAGCCGGG
TTTCAAGCTGTCAATCGATGCAACGCCAAAAGCGGCAATATCCGTTGGTGGTCTGTCCGGCATACCCGGG
TCAGCCAAAAGCGAATCGCCAAACACGGTGAAATGGGTCTGTGTGGCGCAGCCAGCATATCAGCCAAATG
TCGGGGTTGTGACGGAAATGCCTTCATCAACTAAACCCTGGAAACCTTTTGCTACAGGAATGGTGACCAT
GTTGGTGATAAGCGCCACAACGGTATGGGGCTGGAACGCTTTTCACCGACCGGATCCGCTACAGACGCAG
CTTGCTGCATCACTGGCCCCTTTACCTTCGGTGCTCTCTTCCGAGCAACTGGAGGGACTGCGTCAGCAAG
CTCCTCTGCCGGAAACGATAATCAAAAATACCCGGCAGCAGCTCGCCCGCCTTGAGCAATTGCCTCCGGG
CTGGACCTCCCAATATGGCCACCAACTGGTACAACAGGCTTTAATGATGTGGCCAGAGCAGGCAAAAGGA
CTGGCGAGGGAGTGGCAACAGCAGCTTAACGCCGCAGCGCTGCCGACAGAAAACCTGAATGGCTGGCACG
AAGGGATGTCGCAACTGCAGCAACTGAGTCATAAGCTGAATGGGCTGGACGGGCAAAAAGGCAAATACAT
GACGGTCAGCGAACTGAAGTCGGTGGTGTATTCAGCCACTCAGGCGTTTAACCGCTCCATACCCGCAGAG
GAACAGCTGCGACGGTACGCTGTCAACCCTTCTGATATTCAGCGGCGGCAGGTGGAAACAGTCCTGCAGC
AACTCCAGAAGCGCTATGCTTTGTTCAGGCTTGGACAGCAAAAAGAAACAACAATATTGGCAACAGAATG
A