SecReT6
Protein ID: 292489665
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3202
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3293082..3293534 [-]
Producttype VI secretion system core protein
NoteTssE
UniProt IDD4I209
KEGG IDeam:EAMY_3202
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-16, Aligned region: 28..115
Protein Sequence: 150 a.a.     [Download]
>gi|292489665|ref|YP_003532555.1| unnamed protein product [Erwinia amylovora CFBP1430]
MESKSPSLYEILTGNFIGDLPLELISEEDQVILSVLDQIQRIMNSRAGTLSHLPDYGLPDMTQILQGMPG
TAQQLMRILSAVLLKYEPRLKSIKVSMLEQTIPGELRYAIDAELKGMGLVRYGTEFMPEGRVLIRHLKQQ
QYLSLRTSVY
 
Nucleotide Sequence: 453 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3293534-3293082 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGGAAAGTAAATCTCCCTCTCTCTATGAAATTCTTACCGGAAACTTTATCGGTGATTTACCACTTGAAC
TCATTAGCGAAGAAGATCAGGTTATTTTATCCGTACTGGATCAGATTCAACGGATAATGAACTCTCGTGC
CGGTACCCTATCCCATCTGCCAGATTACGGTTTGCCGGATATGACCCAAATTTTGCAAGGAATGCCGGGC
ACTGCCCAGCAATTAATGAGAATACTTTCCGCCGTACTGCTCAAATATGAACCCCGTTTGAAGAGCATTA
AGGTTTCGATGCTTGAGCAGACAATTCCCGGCGAACTGCGCTACGCCATCGATGCCGAACTCAAGGGCAT
GGGTCTGGTGCGCTACGGTACGGAATTTATGCCGGAAGGGCGGGTACTCATCAGGCATTTAAAGCAACAG
CAATATCTTTCCTTGCGGACATCAGTGTACTGA