SecReT6
Protein ID: 292489667
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3204
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3294266..3295156 [-]
Producthypothetical protein
NoteTssI
UniProt IDD4I211
KEGG IDeam:EAMY_3204
PDB IDNA
Domain hit(s) vs Pfam T6SS_Vgr [PF13296], Evalue: 4.60E-28, Aligned region: 48..152
T6SS_Vgr [PF13296], Evalue: 4.60E-28, Aligned region: 184..197
DUF2345 [PF10106], Evalue: 3.60E-24, Aligned region: 131..154
DUF2345 [PF10106], Evalue: 3.60E-24, Aligned region: 179..283
Sarcoglycan_1 [PF04790], Evalue: 0.00048, Aligned region: 11..34
Sarcoglycan_1 [PF04790], Evalue: 0.00048, Aligned region: 148..208
Sarcoglycan_1 [PF04790], Evalue: 0.00048, Aligned region: 218..271
Protein Sequence: 296 a.a.     [Download]
>gi|292489667|ref|YP_003532557.1| unnamed protein product [Erwinia amylovora CFBP1430]
MLSQQCKTITGIRGKAGITVKGESGPYIAHALHDSERPDPVKRDNPTRNILCTAANNQLRMEDKRGEEPI
ALATEYGKTGLNSGHLVDAQGMPRGAGTELRTDERGTIRAGKGLLLSADNQPKALGEVPDRAAALKETGR
LQQQLRQLEMAAEQAQALKADIDSQMRMLAQRLKPLHKIIHFTAPQGMALTSGEDMQLAATENVAMNAGG
DISAGVTGNLAALAGERLGLYARTGPLSLKAGEGPVDMQAQNGNMRLFAEQKLTIASEEDILFAGKKRIT
LIVHFLFVRLFKIDKY
 
Nucleotide Sequence: 891 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3295156-3294266 Erwinia amylovora CFBP1430 chromosome, complete genome
TTGTTATCTCAACAGTGCAAAACAATTACAGGGATCAGAGGAAAAGCAGGAATCACTGTAAAAGGTGAGT
CAGGACCGTATATCGCCCATGCGCTGCACGACTCAGAGCGCCCGGACCCCGTAAAACGCGATAACCCCAC
CCGCAACATTCTGTGCACTGCGGCTAACAACCAGCTGCGGATGGAGGACAAACGCGGCGAGGAGCCTATC
GCACTCGCCACGGAATACGGCAAAACCGGGCTCAATAGCGGCCATCTGGTGGATGCACAGGGCATGCCGC
GCGGTGCCGGTACGGAACTGCGTACCGATGAACGGGGCACGATACGTGCCGGAAAAGGGCTGTTGCTCAG
TGCGGATAACCAGCCGAAAGCCCTGGGCGAAGTGCCGGACAGGGCCGCCGCGCTGAAGGAAACCGGCCGG
CTTCAGCAGCAACTCAGACAGCTTGAAATGGCGGCAGAGCAGGCACAGGCGCTGAAGGCGGATATCGACA
GCCAGATGCGGATGTTAGCGCAACGGCTGAAGCCGCTGCATAAAATCATCCATTTTACCGCCCCGCAGGG
GATGGCACTGACCAGCGGCGAAGATATGCAGCTGGCTGCCACGGAGAACGTGGCGATGAATGCCGGGGGC
GACATCAGCGCGGGCGTGACGGGCAACCTGGCGGCGCTTGCCGGAGAAAGGCTGGGGCTGTATGCCCGGA
CAGGGCCCCTGAGTCTGAAAGCGGGTGAAGGTCCGGTGGATATGCAGGCGCAGAACGGCAATATGCGGCT
GTTTGCGGAGCAGAAGCTGACCATTGCGTCAGAAGAGGACATCCTGTTTGCCGGCAAGAAGCGCATCACG
CTGATTGTTCATTTTTTATTTGTACGGTTATTTAAAATTGATAAATACTAA