SecReT6
Protein ID: 292489669
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3206
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3295981..3296565 [-]
Producthypothetical protein
NoteTssI
UniProt IDD4I213
KEGG IDeam:EAMY_3206
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|292489669|ref|YP_003532559.1| unnamed protein product [Erwinia amylovora CFBP1430]
MNNWLALFDGQSRYVLEIHDSPVHPDVLRFYGREALSEPFTWDIEFTTEQANLAPGQVLMKFVDKLEIME
NGEFKSCYLNFSDLTAIELEKKSQFNYIKIGSTLWEKATDDLDDVYGALDSFIIKVAFTDLDVTRDSSGF
VRLEIKELGLYVRDTYDFINDGDDQLLGYWGSNGVIKPGVISELMKKKIHRQRK
 
Nucleotide Sequence: 585 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3296565-3295981 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAATAACTGGCTGGCGCTTTTTGACGGGCAGAGCCGCTACGTACTGGAGATTCATGACAGCCCGGTAC
ACCCTGATGTGCTGCGCTTTTATGGGCGCGAGGCGCTAAGCGAACCGTTCACATGGGATATTGAATTTAC
CACGGAACAGGCAAATCTTGCCCCCGGACAGGTGCTGATGAAGTTCGTAGATAAGTTAGAGATTATGGAA
AATGGTGAATTTAAGAGTTGCTACCTAAATTTTAGTGACCTGACAGCTATCGAGTTGGAAAAGAAAAGTC
AGTTTAATTATATAAAGATTGGTAGTACGTTGTGGGAAAAAGCAACAGATGATCTGGATGACGTGTATGG
GGCACTTGATTCTTTCATAATCAAAGTCGCGTTTACCGATCTTGATGTCACCAGAGATAGCAGCGGGTTC
GTGAGGCTAGAGATTAAGGAACTTGGTTTATACGTCAGAGATACTTATGATTTCATTAATGATGGTGATG
ATCAGTTGCTGGGATATTGGGGGAGTAATGGGGTGATTAAACCCGGGGTAATAAGTGAGTTAATGAAAAA
AAAGATACATCGACAAAGAAAATGA