SecReT6
Protein ID: 292489670
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3207
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3296570..3296995 [-]
Producthypothetical protein
NoteTssJ
UniProt IDD4I214
KEGG IDeam:EAMY_3207
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-30, Aligned region: 2..131
Protein Sequence: 141 a.a.     [Download]
>gi|292489670|ref|YP_003532560.1| unnamed protein product [Erwinia amylovora CFBP1430]
MTKSIFYKKIRMLHLDFTPRTAMNADGAQIPLATMVRIYQLKDRKAVDAADYRTMLRNADAALKDDLVVS
KELLVMPKGSMTLNMPMDENAQFVAVIGLFNRPDLQDNRWRLVLTRDDLDPDKPRTAELGDGWLSLVPLK
E
 
Nucleotide Sequence: 426 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3296995-3296570 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGACGAAGTCCATCTTCTATAAAAAAATCAGAATGCTGCATCTGGATTTTACCCCGCGTACCGCGATGA
ACGCCGATGGTGCTCAGATCCCGCTGGCAACCATGGTGAGGATCTACCAGCTGAAGGACCGCAAGGCGGT
TGATGCAGCCGATTACCGGACTATGCTGCGCAACGCCGACGCGGCGCTGAAAGATGACCTTGTGGTGTCA
AAAGAGCTGCTGGTGATGCCCAAAGGCAGCATGACGCTGAACATGCCGATGGATGAGAACGCGCAGTTTG
TTGCCGTGATCGGGTTATTTAACCGTCCCGATCTGCAAGACAACCGCTGGCGGCTGGTACTGACCCGTGA
CGATCTTGACCCGGATAAACCGCGCACCGCTGAACTGGGCGATGGCTGGCTCAGCCTTGTGCCGCTAAAG
GAGTGA