SecReT6
Protein ID: 292489674
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3211
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3300382..3302694 [-]
Producttype VI secretion system effector protein VgrG
NoteTssI
UniProt IDD4I218
KEGG IDeam:EAMY_3211
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 33..341
Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 479..517
Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 559..591
DUF2345 [PF10106], Evalue: 5.50E-32, Aligned region: 601..729
T6SS_Vgr [PF13296], Evalue: 1.30E-28, Aligned region: 470..574
T6SS_Vgr [PF13296], Evalue: 1.30E-28, Aligned region: 606..625
Phage_base_V [PF04717], Evalue: 4.90E-11, Aligned region: 390..464
Protein Sequence: 770 a.a.     [Download]
>gi|292489674|ref|YP_003532564.1| unnamed protein product [Erwinia amylovora CFBP1430]
MNNWLALFDGQSRYVLEIHDSPVHPDVLRFYGREALSEPFTWDIEFTTEQANIAPGQVLMKYASLRMRSG
KNVHGIITRLEWRSTTADQSHYTIRLSSRLALLSHSRKCAVYQNQSVPEVVAQVLRQHGLAGADFAFRLV
RTYPPRELITRWRETDLQFIRRLLSEVGIYWRTEMDSTRELDVYIFADSQLNYQFDVRLPYSEPSGLFDG
AEESVWDVRSWHNVVTGSVVTRDHNYRTAATPLNATVSVRNDAVTSGEHYRYAAPYQEAGDDSDPEPETE
SGAFYARMHHERELNQSARIHLFSNAPHLTPGQVLEPQGDVINALKEGVIITLATYRASRDTRLHVSVWG
MPYSERYSFRPVEIPRPAIHGTLPARIESGEKNDIYAHPDEQGRYRVRLDFDREGTGPGYLWLRMAKPYS
GETSGWHMPLVDGTGVAIAWGNGDIDLPYIAHALHDSEHPDPVNRDNPTRNILCTAANNQLRMEDKRGEE
HIALATEYGKTGLNSGHLVDAQGMPRGAGTELRTDERGTIRAGKGLLLSADNQPKAQGEVPDRAAALKET
GRLQQQLRQLEMAAEQAQALKADIDSQMRMLAQRLKPLHKIIHFTAPQGMALTSGEDTQLAATENLAMNA
GGDISAGVTGNLAALAGERLGLYARTGPLSLKAGEGPVDMQAQNGNMRLFAEQKLTIASEEDILFAGKKR
ITLTGGGGSYLRLEAGKVEYGTTGTYRRRVKRTMVAGAANLPLPFRNKGLCLSCLMDAAMNGTPVVLRGN
 
Nucleotide Sequence: 2313 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3302694-3300382 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAATAACTGGCTGGCGCTTTTTGACGGGCAGAGCCGCTACGTACTGGAGATTCATGACAGCCCGGTAC
ACCCTGATGTGCTGCGCTTTTATGGGCGCGAGGCGTTAAGCGAACCGTTCACATGGGATATTGAATTCAC
CACGGAACAGGCAAATATTGCCCCCGGACAGGTGCTGATGAAGTACGCGTCCTTGCGGATGCGCAGCGGC
AAAAATGTCCACGGCATCATTACCCGCCTGGAATGGCGGTCAACGACAGCTGACCAGTCGCACTACACAA
TCAGGCTCAGCTCGCGCCTGGCGCTGCTGTCGCACAGCCGGAAATGCGCCGTATACCAGAATCAGTCGGT
ACCGGAGGTGGTGGCACAGGTGCTGCGCCAGCACGGACTGGCAGGGGCTGATTTTGCATTTCGTCTGGTG
CGCACCTACCCGCCGCGTGAGCTGATAACCCGGTGGCGGGAGACGGATTTGCAGTTTATCCGGCGGCTGT
TGTCGGAAGTGGGGATTTACTGGCGCACGGAGATGGACAGCACGCGGGAGCTGGACGTGTACATCTTTGC
CGACAGCCAGCTTAACTACCAGTTTGACGTGCGCCTGCCGTACAGCGAGCCGTCTGGGTTGTTCGACGGT
GCGGAAGAATCGGTGTGGGACGTGCGCAGCTGGCATAACGTGGTCACCGGCAGCGTCGTTACCCGCGACC
ACAACTACCGCACGGCCGCCACGCCGCTGAATGCGACCGTCAGCGTGCGCAACGATGCGGTGACCAGCGG
TGAACACTATCGTTACGCCGCCCCGTACCAAGAAGCCGGGGACGACAGCGACCCGGAGCCTGAAACGGAA
AGCGGGGCGTTTTACGCCCGCATGCATCACGAGCGCGAACTGAATCAGTCCGCGCGCATTCACCTGTTCA
GTAACGCCCCGCACCTGACGCCGGGTCAGGTGCTGGAGCCGCAGGGCGATGTGATAAATGCGCTGAAAGA
GGGGGTTATCATCACGCTTGCCACTTACCGCGCCTCGCGTGATACCCGCCTGCACGTATCGGTATGGGGA
ATGCCATACAGCGAGCGCTACAGCTTCCGTCCGGTGGAAATCCCGCGTCCGGCCATCCACGGCACGCTGC
CGGCGCGCATTGAGAGCGGGGAAAAGAACGACATTTATGCGCACCCGGATGAGCAGGGCCGCTACCGGGT
GAGGCTGGATTTTGACCGCGAAGGTACGGGCCCGGGTTATCTGTGGCTGCGCATGGCGAAACCCTACTCC
GGAGAGACCTCCGGCTGGCATATGCCGCTTGTCGACGGCACCGGAGTGGCGATTGCCTGGGGCAACGGCG
ACATTGACCTGCCGTATATCGCCCATGCGCTGCACGACTCAGAGCACCCGGACCCCGTAAACCGCGATAA
CCCCACCCGCAATATTCTGTGCACTGCGGCTAACAACCAGCTGCGGATGGAGGACAAACGCGGCGAGGAG
CATATCGCACTCGCCACGGAATACGGCAAAACCGGGCTCAATAGCGGCCATCTGGTGGATGCACAGGGCA
TGCCGCGCGGTGCCGGTACGGAACTGCGTACCGATGAACGGGGCACGATACGTGCCGGAAAAGGGCTGTT
GCTCAGTGCGGATAACCAGCCGAAAGCCCAGGGCGAAGTGCCGGACAGGGCCGCCGCGCTGAAGGAAACC
GGCCGGCTTCAGCAGCAACTCAGACAGCTTGAAATGGCGGCAGAGCAGGCACAGGCGCTGAAGGCGGATA
TCGACAGCCAGATGCGGATGTTAGCGCAACGGCTGAAGCCGCTGCATAAAATCATCCATTTTACCGCCCC
GCAGGGGATGGCACTGACCAGCGGCGAAGATACGCAGCTGGCTGCCACGGAGAACTTGGCGATGAATGCC
GGGGGCGACATCAGCGCGGGCGTGACGGGCAACCTGGCGGCGCTTGCCGGAGAAAGGCTGGGGCTGTATG
CCCGGACGGGGCCCCTGAGTCTGAAAGCGGGTGAAGGTCCGGTGGATATGCAGGCGCAGAACGGCAATAT
GCGGCTGTTTGCGGAGCAGAAGCTGACCATTGCGTCAGAAGAGGACATCCTGTTTGCCGGCAAGAAGCGC
ATCACGCTGACAGGCGGAGGCGGCAGTTATCTGCGGCTTGAGGCGGGGAAAGTGGAGTACGGCACTACCG
GAACGTACAGGCGGCGGGTGAAAAGGACGATGGTGGCTGGGGCGGCGAATCTGCCACTTCCGTTCAGGAA
TAAGGGGTTATGCCTGAGTTGTCTGATGGATGCAGCGATGAATGGAACACCTGTAGTACTGAGGGGGAAT
TAA