SecReT6
Protein ID: 292489674
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3211
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3300382..3302694 [-]
Producttype VI secretion system effector protein VgrG
NoteTssI
UniProt IDD4I218
KEGG IDeam:EAMY_3211
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 33..341
Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 479..517
Phage_GPD [PF05954], Evalue: 7.90E-58, Aligned region: 559..591
DUF2345 [PF10106], Evalue: 5.50E-32, Aligned region: 601..729
T6SS_Vgr [PF13296], Evalue: 1.30E-28, Aligned region: 470..574
T6SS_Vgr [PF13296], Evalue: 1.30E-28, Aligned region: 606..625
Phage_base_V [PF04717], Evalue: 4.90E-11, Aligned region: 390..464
Protein Sequence: 770 a.a.     [Download]
>gi|292489674|ref|YP_003532564.1| unnamed protein product [Erwinia amylovora CFBP1430]
MNNWLALFDGQSRYVLEIHDSPVHPDVLRFYGREALSEPFTWDIEFTTEQANIAPGQVLMKYASLRMRSG
KNVHGIITRLEWRSTTADQSHYTIRLSSRLALLSHSRKCAVYQNQSVPEVVAQVLRQHGLAGADFAFRLV
RTYPPRELITRWRETDLQFIRRLLSEVGIYWRTEMDSTRELDVYIFADSQLNYQFDVRLPYSEPSGLFDG
AEESVWDVRSWHNVVTGSVVTRDHNYRTAATPLNATVSVRNDAVTSGEHYRYAAPYQEAGDDSDPEPETE
SGAFYARMHHERELNQSARIHLFSNAPHLTPGQVLEPQGDVINALKEGVIITLATYRASRDTRLHVSVWG
MPYSERYSFRPVEIPRPAIHGTLPARIESGEKNDIYAHPDEQGRYRVRLDFDREGTGPGYLWLRMAKPYS
GETSGWHMPLVDGTGVAIAWGNGDIDLPYIAHALHDSEHPDPVNRDNPTRNILCTAANNQLRMEDKRGEE
HIALATEYGKTGLNSGHLVDAQGMPRGAGTELRTDERGTIRAGKGLLLSADNQPKAQGEVPDRAAALKET
GRLQQQLRQLEMAAEQAQALKADIDSQMRMLAQRLKPLHKIIHFTAPQGMALTSGEDTQLAATENLAMNA
GGDISAGVTGNLAALAGERLGLYARTGPLSLKAGEGPVDMQAQNGNMRLFAEQKLTIASEEDILFAGKKR
ITLTGGGGSYLRLEAGKVEYGTTGTYRRRVKRTMVAGAANLPLPFRNKGLCLSCLMDAAMNGTPVVLRGN
 
Nucleotide Sequence: 2313 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3302694-3300382 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAATAACTGGCTGGCGCTTTTTGACGGGCAGAGCCGCTACGTACTGGAGATTCATGACAGCCCGGTAC
ACCCTGATGTGCTGCGCTTTTATGGGCGCGAGGCGTTAAGCGAACCGTTCACATGGGATATTGAATTCAC
CACGGAACAGGCAAATATTGCCCCCGGACAGGTGCTGATGAAGTACGCGTCCTTGCGGATGCGCAGCGGC
AAAAATGTCCACGGCATCATTACCCGCCTGGAATGGCGGTCAACGACAGCTGACCAGTCGCACTACACAA
TCAGGCTCAGCTCGCGCCTGGCGCTGCTGTCGCACAGCCGGAAATGCGCCGTATACCAGAATCAGTCGGT
ACCGGAGGTGGTGGCACAGGTGCTGCGCCAGCACGGACTGGCAGGGGCTGATTTTGCATTTCGTCTGGTG
CGCACCTACCCGCCGCGTGAGCTGATAACCCGGTGGCGGGAGACGGATTTGCAGTTTATCCGGCGGCTGT
TGTCGGAAGTGGGGATTTACTGGCGCACGGAGATGGACAGCACGCGGGAGCTGGACGTGTACATCTTTGC
CGACAGCCAGCTTAACTACCAGTTTGACGTGCGCCTGCCGTACAGCGAGCCGTCTGGGTTGTTCGACGGT
GCGGAAGAATCGGTGTGGGACGTGCGCAGCTGGCATAACGTGGTCACCGGCAGCGTCGTTACCCGCGACC
ACAACTACCGCACGGCCGCCACGCCGCTGAATGCGACCGTCAGCGTGCGCAACGATGCGGTGACCAGCGG
TGAACACTATCGTTACGCCGCCCCGTACCAAGAAGCCGGGGACGACAGCGACCCGGAGCCTGAAACGGAA
AGCGGGGCGTTTTACGCCCGCATGCATCACGAGCGCGAACTGAATCAGTCCGCGCGCATTCACCTGTTCA
GTAACGCCCCGCACCTGACGCCGGGTCAGGTGCTGGAGCCGCAGGGCGATGTGATAAATGCGCTGAAAGA
GGGGGTTATCATCACGCTTGCCACTTACCGCGCCTCGCGTGATACCCGCCTGCACGTATCGGTATGGGGA
ATGCCATACAGCGAGCGCTACAGCTTCCGTCCGGTGGAAATCCCGCGTCCGGCCATCCACGGCACGCTGC
CGGCGCGCATTGAGAGCGGGGAAAAGAACGACATTTATGCGCACCCGGATGAGCAGGGCCGCTACCGGGT
GAGGCTGGATTTTGACCGCGAAGGTACGGGCCCGGGTTATCTGTGGCTGCGCATGGCGAAACCCTACTCC
GGAGAGACCTCCGGCTGGCATATGCCGCTTGTCGACGGCACCGGAGTGGCGATTGCCTGGGGCAACGGCG
ACATTGACCTGCCGTATATCGCCCATGCGCTGCACGACTCAGAGCACCCGGACCCCGTAAACCGCGATAA
CCCCACCCGCAATATTCTGTGCACTGCGGCTAACAACCAGCTGCGGATGGAGGACAAACGCGGCGAGGAG
CATATCGCACTCGCCACGGAATACGGCAAAACCGGGCTCAATAGCGGCCATCTGGTGGATGCACAGGGCA
TGCCGCGCGGTGCCGGTACGGAACTGCGTACCGATGAACGGGGCACGATACGTGCCGGAAAAGGGCTGTT
GCTCAGTGCGGATAACCAGCCGAAAGCCCAGGGCGAAGTGCCGGACAGGGCCGCCGCGCTGAAGGAAACC
GGCCGGCTTCAGCAGCAACTCAGACAGCTTGAAATGGCGGCAGAGCAGGCACAGGCGCTGAAGGCGGATA
TCGACAGCCAGATGCGGATGTTAGCGCAACGGCTGAAGCCGCTGCATAAAATCATCCATTTTACCGCCCC
GCAGGGGATGGCACTGACCAGCGGCGAAGATACGCAGCTGGCTGCCACGGAGAACTTGGCGATGAATGCC
GGGGGCGACATCAGCGCGGGCGTGACGGGCAACCTGGCGGCGCTTGCCGGAGAAAGGCTGGGGCTGTATG
CCCGGACGGGGCCCCTGAGTCTGAAAGCGGGTGAAGGTCCGGTGGATATGCAGGCGCAGAACGGCAATAT
GCGGCTGTTTGCGGAGCAGAAGCTGACCATTGCGTCAGAAGAGGACATCCTGTTTGCCGGCAAGAAGCGC
ATCACGCTGACAGGCGGAGGCGGCAGTTATCTGCGGCTTGAGGCGGGGAAAGTGGAGTACGGCACTACCG
GAACGTACAGGCGGCGGGTGAAAAGGACGATGGTGGCTGGGGCGGCGAATCTGCCACTTCCGTTCAGGAA
TAAGGGGTTATGCCTGAGTTGTCTGATGGATGCAGCGATGAATGGAACACCTGTAGTACTGAGGGGGAAT
TAA

Protein ID: 292489683
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3220
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3313420..3315777 [-]
Producttype VI secretion system effector protein VgrG
NoteTssI
UniProt IDD4I227
KEGG IDeam:EAMY_3220
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-62, Aligned region: 41..355
DUF2345 [PF10106], Evalue: 2.10E-41, Aligned region: 610..753
T6SS_Vgr [PF13296], Evalue: 2.40E-36, Aligned region: 486..591
T6SS_Vgr [PF13296], Evalue: 2.40E-36, Aligned region: 634..653
Phage_base_V [PF04717], Evalue: 4.40E-15, Aligned region: 400..481
Phage_base_V [PF04717], Evalue: 4.40E-15, Aligned region: 752..766
Protein Sequence: 785 a.a.     [Download]
>gi|292489683|ref|YP_003532573.1| unnamed protein product [Erwinia amylovora CFBP1430]
MSNSVINLTGQKTQQLPGQSRYRMDVHNCPHCLDVLSFRAEESFSRPWHYAVSLTCQTPDLNCDTLLLKP
ASFTCQTPLFSGAPAAPVRTVFGVVSAFRRLSTSEDETRYALTLVPRIALLAHTKGSEVFLNQSVIEVVE
QVLRKHGLEGPDFEFRLSREYPARELITQWRETDLEFVQRLLAEVGIFWRFEMDGRLEQDVVIFQDSQEQ
YQFGVTLPLRNPAGMSDSGQESIWGIHTAYNVVSGRVTTRDYNYREALTPQDSSESISGKEGITTGEVCH
YAEPFLTAGDTDNTETGAYFARLRHERILNGQSTVSGRSSSPFLAPGQVLEADTRLPDAVKDGIVITTVR
SSGSRKSSFTLTFEGIPYSETVCYRPALINRPVISGSLPARVESAQKGDIYAWLDEQGRYRVRMDFDRNS
TEQGYAYLWLRMAKPYAGDTYGWHAPLLDGTEVSVVFDSGDPDRPYIACAQHDSEHPDHVTSDNPTRNIW
RTPANNKLRMEDKRQEEHIKLATEYGKTQLNLGHLVNAQREQRGAGFELRTDEFGVVRAGKGLFLTADEQ
LKAQGPVLEMKQAINQINQANSQMQSLNSAAEAAGALVSDISTQISLVTERLKNLQSAVLLASAPQGVAL
TSGEHLQLTSTRNTMINAGQHLDIGAMKNLSISVEKALGLFVHKDGAKLIANQGDVEIQARHNTMALFAR
QQITVTSSDDEIVISTPKTLTLNGGGSYLKLSQNGIEHGSCGDYLIKAAHYQVLVGGASLDTERPVFDKT
SLELLPPVTDDDMSR
 
Nucleotide Sequence: 2358 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3315777-3313420 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAGTAATAGTGTAATTAATCTGACTGGACAAAAAACACAGCAACTTCCCGGCCAGTCCCGATACCGTA
TGGATGTACATAACTGCCCGCATTGTTTGGATGTGTTGAGTTTTCGGGCAGAAGAATCATTCAGCCGGCC
CTGGCACTACGCGGTGTCACTCACTTGCCAAACGCCGGATCTCAACTGCGACACGCTGCTGCTGAAACCC
GCCTCATTTACCTGTCAGACGCCGTTGTTTAGCGGTGCGCCTGCCGCGCCGGTGCGTACCGTTTTTGGCG
TGGTGAGCGCGTTTCGCCGCTTATCCACCTCTGAAGATGAAACCCGATATGCATTGACGCTGGTGCCGCG
GATTGCCCTGTTAGCGCACACGAAAGGCAGTGAAGTTTTTCTCAACCAGTCCGTTATCGAAGTGGTGGAG
CAGGTATTGCGCAAGCATGGTCTGGAGGGGCCTGACTTTGAGTTCCGCCTGTCGCGTGAGTACCCAGCCC
GCGAGCTTATTACCCAGTGGCGGGAAACCGATCTTGAATTTGTGCAGCGCCTGCTGGCAGAGGTGGGGAT
TTTCTGGCGCTTTGAAATGGACGGCCGACTTGAACAGGACGTGGTGATATTCCAGGATAGCCAGGAGCAG
TATCAGTTCGGCGTGACCCTGCCGCTGCGCAACCCTGCCGGGATGAGCGACAGCGGCCAGGAAAGCATCT
GGGGCATCCACACCGCTTACAACGTGGTGAGTGGCCGTGTCACCACCCGTGATTACAACTACCGCGAGGC
GCTTACGCCGCAGGACAGCTCGGAAAGCATCAGCGGTAAAGAAGGCATCACTACCGGTGAGGTTTGTCAT
TACGCGGAGCCATTCCTCACTGCCGGCGATACTGATAACACGGAAACAGGGGCTTATTTTGCCCGACTGC
GACACGAACGTATTCTGAACGGGCAATCTACCGTCAGCGGCCGTTCCTCCAGCCCCTTTCTGGCCCCCGG
ACAGGTGTTGGAAGCCGATACCCGTCTGCCTGATGCCGTAAAAGACGGCATTGTTATCACCACTGTACGC
AGCAGTGGTTCACGTAAAAGCAGCTTCACGCTCACGTTTGAAGGTATTCCGTACAGCGAAACCGTCTGCT
ACCGCCCGGCGCTCATCAATCGCCCGGTCATTTCCGGTTCCCTGCCGGCCCGTGTGGAAAGCGCCCAAAA
AGGCGATATCTACGCCTGGCTGGACGAGCAGGGGCGCTACCGCGTGAGGATGGACTTCGACCGCAACAGC
ACCGAACAAGGTTATGCATATCTGTGGCTGCGGATGGCAAAGCCGTATGCCGGCGATACCTACGGCTGGC
ATGCGCCGCTTCTCGACGGCACGGAAGTGTCCGTGGTGTTTGACAGCGGCGACCCGGATCGCCCGTATAT
CGCCTGTGCCCAGCACGATTCCGAACATCCCGACCACGTCACCAGCGATAACCCTACGCGCAACATCTGG
CGCACACCGGCAAATAACAAGCTACGCATGGAGGATAAGCGCCAGGAAGAGCATATCAAGCTCGCCACGG
AATACGGCAAGACCCAGCTCAACCTGGGCCACCTGGTCAACGCACAGCGTGAACAACGTGGGGCGGGTTT
TGAATTACGCACTGACGAATTCGGCGTGGTTCGTGCAGGAAAAGGCCTGTTCCTGACGGCGGATGAACAG
CTGAAAGCACAGGGGCCGGTGCTGGAAATGAAACAGGCTATAAACCAGATTAATCAGGCCAACAGCCAGA
TGCAGTCACTGAACAGTGCCGCAGAAGCCGCAGGGGCGCTGGTATCAGACATCAGCACCCAGATAAGCCT
GGTGACAGAACGGCTTAAAAACCTTCAGTCCGCCGTTCTGCTGGCCAGTGCACCGCAGGGCGTGGCGCTG
ACCTCAGGTGAGCACCTACAGCTCACCAGCACCCGTAACACCATGATTAACGCGGGCCAGCACCTTGACA
TCGGGGCAATGAAAAACCTGTCCATCTCGGTTGAAAAAGCGCTGGGGCTGTTCGTGCATAAAGACGGCGC
TAAGCTGATCGCCAATCAGGGAGATGTGGAAATTCAGGCCCGGCACAACACCATGGCGCTCTTCGCCAGG
CAGCAAATAACGGTCACCAGCAGCGATGACGAAATTGTTATCAGCACGCCGAAAACGCTGACGCTGAACG
GCGGCGGTTCGTACCTTAAGTTGAGTCAGAATGGGATCGAACATGGATCTTGCGGTGATTATCTGATCAA
AGCCGCCCACTACCAAGTGCTTGTGGGGGGAGCTTCATTGGATACCGAAAGGCCGGTTTTTGACAAGACT
TCTCTTGAGCTTTTGCCCCCTGTAACCGATGACGATATGTCACGCTAA

Protein ID: 292489669
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3206
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3295981..3296565 [-]
Producthypothetical protein
NoteTssI
UniProt IDD4I213
KEGG IDeam:EAMY_3206
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|292489669|ref|YP_003532559.1| unnamed protein product [Erwinia amylovora CFBP1430]
MNNWLALFDGQSRYVLEIHDSPVHPDVLRFYGREALSEPFTWDIEFTTEQANLAPGQVLMKFVDKLEIME
NGEFKSCYLNFSDLTAIELEKKSQFNYIKIGSTLWEKATDDLDDVYGALDSFIIKVAFTDLDVTRDSSGF
VRLEIKELGLYVRDTYDFINDGDDQLLGYWGSNGVIKPGVISELMKKKIHRQRK
 
Nucleotide Sequence: 585 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3296565-3295981 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGAATAACTGGCTGGCGCTTTTTGACGGGCAGAGCCGCTACGTACTGGAGATTCATGACAGCCCGGTAC
ACCCTGATGTGCTGCGCTTTTATGGGCGCGAGGCGCTAAGCGAACCGTTCACATGGGATATTGAATTTAC
CACGGAACAGGCAAATCTTGCCCCCGGACAGGTGCTGATGAAGTTCGTAGATAAGTTAGAGATTATGGAA
AATGGTGAATTTAAGAGTTGCTACCTAAATTTTAGTGACCTGACAGCTATCGAGTTGGAAAAGAAAAGTC
AGTTTAATTATATAAAGATTGGTAGTACGTTGTGGGAAAAAGCAACAGATGATCTGGATGACGTGTATGG
GGCACTTGATTCTTTCATAATCAAAGTCGCGTTTACCGATCTTGATGTCACCAGAGATAGCAGCGGGTTC
GTGAGGCTAGAGATTAAGGAACTTGGTTTATACGTCAGAGATACTTATGATTTCATTAATGATGGTGATG
ATCAGTTGCTGGGATATTGGGGGAGTAATGGGGTGATTAAACCCGGGGTAATAAGTGAGTTAATGAAAAA
AAAGATACATCGACAAAGAAAATGA

Protein ID: 292489667
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3204
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3294266..3295156 [-]
Producthypothetical protein
NoteTssI
UniProt IDD4I211
KEGG IDeam:EAMY_3204
PDB IDNA
Domain hit(s) vs Pfam T6SS_Vgr [PF13296], Evalue: 4.60E-28, Aligned region: 48..152
T6SS_Vgr [PF13296], Evalue: 4.60E-28, Aligned region: 184..197
DUF2345 [PF10106], Evalue: 3.60E-24, Aligned region: 131..154
DUF2345 [PF10106], Evalue: 3.60E-24, Aligned region: 179..283
Sarcoglycan_1 [PF04790], Evalue: 0.00048, Aligned region: 11..34
Sarcoglycan_1 [PF04790], Evalue: 0.00048, Aligned region: 148..208
Sarcoglycan_1 [PF04790], Evalue: 0.00048, Aligned region: 218..271
Protein Sequence: 296 a.a.     [Download]
>gi|292489667|ref|YP_003532557.1| unnamed protein product [Erwinia amylovora CFBP1430]
MLSQQCKTITGIRGKAGITVKGESGPYIAHALHDSERPDPVKRDNPTRNILCTAANNQLRMEDKRGEEPI
ALATEYGKTGLNSGHLVDAQGMPRGAGTELRTDERGTIRAGKGLLLSADNQPKALGEVPDRAAALKETGR
LQQQLRQLEMAAEQAQALKADIDSQMRMLAQRLKPLHKIIHFTAPQGMALTSGEDMQLAATENVAMNAGG
DISAGVTGNLAALAGERLGLYARTGPLSLKAGEGPVDMQAQNGNMRLFAEQKLTIASEEDILFAGKKRIT
LIVHFLFVRLFKIDKY
 
Nucleotide Sequence: 891 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3295156-3294266 Erwinia amylovora CFBP1430 chromosome, complete genome
TTGTTATCTCAACAGTGCAAAACAATTACAGGGATCAGAGGAAAAGCAGGAATCACTGTAAAAGGTGAGT
CAGGACCGTATATCGCCCATGCGCTGCACGACTCAGAGCGCCCGGACCCCGTAAAACGCGATAACCCCAC
CCGCAACATTCTGTGCACTGCGGCTAACAACCAGCTGCGGATGGAGGACAAACGCGGCGAGGAGCCTATC
GCACTCGCCACGGAATACGGCAAAACCGGGCTCAATAGCGGCCATCTGGTGGATGCACAGGGCATGCCGC
GCGGTGCCGGTACGGAACTGCGTACCGATGAACGGGGCACGATACGTGCCGGAAAAGGGCTGTTGCTCAG
TGCGGATAACCAGCCGAAAGCCCTGGGCGAAGTGCCGGACAGGGCCGCCGCGCTGAAGGAAACCGGCCGG
CTTCAGCAGCAACTCAGACAGCTTGAAATGGCGGCAGAGCAGGCACAGGCGCTGAAGGCGGATATCGACA
GCCAGATGCGGATGTTAGCGCAACGGCTGAAGCCGCTGCATAAAATCATCCATTTTACCGCCCCGCAGGG
GATGGCACTGACCAGCGGCGAAGATATGCAGCTGGCTGCCACGGAGAACGTGGCGATGAATGCCGGGGGC
GACATCAGCGCGGGCGTGACGGGCAACCTGGCGGCGCTTGCCGGAGAAAGGCTGGGGCTGTATGCCCGGA
CAGGGCCCCTGAGTCTGAAAGCGGGTGAAGGTCCGGTGGATATGCAGGCGCAGAACGGCAATATGCGGCT
GTTTGCGGAGCAGAAGCTGACCATTGCGTCAGAAGAGGACATCCTGTTTGCCGGCAAGAAGCGCATCACG
CTGATTGTTCATTTTTTATTTGTACGGTTATTTAAAATTGATAAATACTAA