SecReT6
Protein ID: 292489675
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3212
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3302699..3303223 [-]
Producttype VI secretion system core protein
NoteTssJ
UniProt IDD4I219
KEGG IDeam:EAMY_3212
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-33, Aligned region: 15..164
Protein Sequence: 174 a.a.     [Download]
>gi|292489675|ref|YP_003532565.1| unnamed protein product [Erwinia amylovora CFBP1430]
MTRVNRRRALTLMACCLLAGCGLTRAVTDGTVNMTKSIFYKKIRMLHLDFTPRTAMNADGAQIPLATMVR
IYQLKDRKAVDAADYRTMLRNADAALKDDLVVSKELLVMPKGSMTLNMPMDENAQFVAVIGLFNRPDLQD
NRWRLVLTRDDPDPDKPRTAELGDGWLSLVPLKE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3303223-3302699 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGACAAGAGTAAACCGGAGGCGGGCGCTAACGCTCATGGCCTGCTGCCTGCTTGCAGGCTGCGGCCTGA
CCCGTGCCGTCACCGACGGCACGGTAAACATGACGAAGTCCATCTTCTATAAAAAAATCAGAATGCTGCA
TCTGGATTTTACCCCGCGTACCGCGATGAACGCCGATGGTGCTCAGATCCCGCTGGCAACCATGGTGAGG
ATCTACCAGCTGAAGGACCGCAAGGCGGTTGATGCAGCCGATTACCGGACTATGCTGCGCAACGCCGACG
CGGCGCTGAAAGATGACCTTGTGGTGTCAAAAGAGCTGCTGGTGATGCCCAAAGGCAGCATGACGCTGAA
CATGCCGATGGATGAGAACGCGCAGTTTGTTGCCGTGATCGGGTTATTTAACCGTCCCGATCTGCAAGAC
AACCGCTGGCGGCTGGTACTGACCCGTGACGATCCTGACCCGGATAAACCGCGCACCGCTGAACTGGGCG
ATGGCTGGCTCAGCCTTGTGCCGCTAAAGGAGTGA