SecReT6
Protein ID: 292489676
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3213
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3303249..3304331 [-]
Producttype VI secretion system core protein
NoteTssG
UniProt IDD4I220
KEGG IDeam:EAMY_3213
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-81, Aligned region: 18..319
Protein Sequence: 360 a.a.     [Download]
>gi|292489676|ref|YP_003532566.1| unnamed protein product [Erwinia amylovora CFBP1430]
MERNSQPARTGLTLALNKDIWRANFYRFCQLLEQENPDSPRLGATSHPGSDPVRFRPWPGMGFPVSTLKT
VETDEDHPELPPTVRTTFLGMYGVDSPLPSSYLDDIAQRREGHEAVSSFLDIFSHRITTQYYRIWRKYAY
PATFEAGGRDATSQCLLGLVGLGIPGTAEQVTTPISRFLALLGTMRLPTRNAEGIRALVRLLAPDTRATL
IQPDSVRVHINNRSGLGAGNRVRLSQRATLGKTAKEACSRVLVVLETENPQEAEGWLPGGHMHTDLLALM
RVYLGYRSAARLRLTVPVRLLPEPRLGNSRRIQLGRTGLAGLKDGKLSIDRQTLTVSLGCYEGLQCASLP
PAEDGHYRFK
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3304331-3303249 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGGAACGAAATTCACAGCCAGCACGTACCGGGCTGACGTTAGCCCTCAATAAAGACATCTGGCGGGCCA
ACTTTTACCGCTTTTGCCAGCTGCTGGAGCAGGAAAACCCGGATTCACCCAGGCTGGGGGCGACCAGCCA
TCCGGGCAGCGATCCGGTACGGTTCAGGCCGTGGCCGGGGATGGGTTTTCCGGTCAGTACCCTGAAAACC
GTGGAGACCGACGAAGACCATCCCGAACTTCCTCCGACCGTACGCACCACTTTTTTGGGCATGTACGGCG
TGGATTCACCGCTACCCAGTTCGTATCTGGATGATATTGCACAGCGGCGGGAAGGACATGAGGCAGTTAG
CTCATTTCTGGATATCTTCAGCCACCGTATCACCACCCAGTATTACCGTATCTGGCGCAAATATGCCTAC
CCGGCCACTTTTGAAGCTGGCGGCCGTGACGCCACCTCACAGTGTCTGCTGGGGCTGGTGGGGCTGGGTA
TTCCGGGCACGGCTGAACAAGTGACCACCCCCATCTCGCGTTTTCTGGCGTTGCTGGGCACCATGCGTTT
ACCTACCCGCAACGCCGAGGGGATACGCGCCCTGGTCCGTCTGCTGGCGCCTGATACGCGGGCCACCCTC
ATCCAGCCCGATTCGGTCAGGGTCCATATCAACAACCGCAGCGGTCTGGGGGCGGGGAACCGCGTCCGGC
TGTCGCAGCGGGCCACGCTGGGTAAGACCGCTAAAGAAGCCTGCAGCAGGGTGCTGGTGGTGCTGGAGAC
TGAAAATCCGCAGGAGGCAGAAGGCTGGTTACCGGGGGGTCACATGCACACCGACCTGCTGGCGCTGATG
CGCGTCTATCTGGGATATCGCAGCGCTGCCCGGCTGCGCCTTACCGTACCGGTGCGGTTGCTGCCCGAAC
CCCGACTGGGTAACAGCAGACGCATACAGCTGGGGCGAACTGGGCTGGCCGGTCTTAAAGACGGCAAACT
CAGTATTGATCGGCAAACCCTGACGGTCAGCCTGGGCTGCTATGAGGGGCTGCAATGTGCTTCATTGCCT
CCGGCTGAAGATGGCCATTACCGCTTTAAATAA