SecReT6
Protein ID: 292489677
SecReT6 ID387
T6SS typei2
Gene symbol-
Locus tagEAMY_3214
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3304295..3306064 [-]
Producttype VI secretion system core protein
NoteTssF
UniProt IDD4I221
KEGG IDeam:EAMY_3214
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.70E-178, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|292489677|ref|YP_003532567.1| unnamed protein product [Erwinia amylovora CFBP1430]
MDDLTLRYFDAEMRYLREAGKEFAHAHPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLAIVEFSPDWHRLRQSECLSEGFSVLSRPVGPHQTACQYRTTRDLLLQPLH
LADARLHTETDGRSAIRLRFECTEKVDWSKAGADKVAIFLNAESPLSSALHLALTRRVHAMYARHVATGT
ERRRFDGWCKPMGFDDHDGLWQKADSAFSGYQLLLEYFSFRPKFMFIELRGLETVGLNSASRWFEIDIVL
TEAWSSDLPFTSENFRLHCAPVINLFTLEADPLTLNPLDNEYLLRPLRLQDGHTEIYSVDNIHGAVKHGK
HPYVPFTSFRHRGGMMRHDAPERYYHTRVKRGVSGLYNTWLILGGRSFELDQLSEKPESLSMRITATNGQ
LPRKALESTLLDRVVKAGKVPVKVLNVSAPTLPLYPPANDRFHWRVMSHLGSNFLSMMDNPEVLRGTLAL
YDWSNDEINRRRLEAIVAVKHTLIRRFEKGFMLRGVDIEVTLNADNFAGEGDVNLFGEMLHRFFGLYADI
HLFNQLTLLLQPTGKRLRWNEIHSQHVPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3306064-3304295 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGGATGATTTAACGCTGCGCTACTTTGACGCAGAAATGCGCTACTTGCGGGAGGCCGGTAAAGAGTTTG
CCCACGCTCACCCGGACCGGGCGGCAATGCTTAACCTGGATAAACCCGGCGCGCGCGACCCGTACGTCGA
ACGCCTGTTTGAAGGTTTCGCCTTTCTGATGGGGCGTCTGCGTGAAAAACTTGATGATGACCTGCCAGAG
TTGACTGAAGGCTTAGTCAGCCTGTTGTGGCCGCATTACATGCGCACCATTCCGTCGCTGGCCATCGTGG
AGTTTTCCCCCGACTGGCACCGTCTTCGCCAGTCTGAGTGTCTGTCGGAGGGTTTTTCTGTCCTGTCCCG
TCCCGTGGGGCCGCATCAAACTGCCTGCCAGTACCGGACCACCCGTGACCTCCTGCTGCAGCCGCTGCAT
CTGGCGGATGCGCGCCTGCACACCGAAACCGATGGTCGCTCTGCAATCCGTTTGCGTTTTGAGTGCACGG
AGAAAGTGGACTGGAGCAAAGCCGGGGCAGACAAGGTCGCCATTTTTCTCAATGCCGAAAGCCCGCTCAG
CTCGGCACTGCATCTGGCATTGACCCGCCGGGTTCACGCCATGTATGCCCGACATGTAGCTACCGGTACT
GAACGCCGCAGGTTTGATGGCTGGTGTAAACCCATGGGTTTTGATGACCATGACGGGCTGTGGCAGAAGG
CCGATTCCGCCTTCAGCGGTTATCAGCTGTTGCTGGAATACTTCAGTTTCCGGCCGAAGTTTATGTTTAT
TGAGCTGCGCGGTCTTGAGACCGTTGGGCTTAACTCTGCCAGCCGCTGGTTTGAAATCGATATCGTTCTG
ACGGAGGCCTGGTCATCCGACTTACCGTTTACAAGCGAGAACTTCCGCCTGCACTGTGCGCCGGTGATTA
ACCTCTTTACCCTCGAAGCCGATCCGCTGACGCTTAACCCGCTGGACAATGAATATCTGCTGCGCCCGCT
GCGTCTGCAGGACGGCCATACCGAAATCTACAGCGTGGATAACATCCACGGCGCGGTGAAACACGGCAAG
CACCCGTACGTACCTTTTACCAGCTTCCGCCACCGGGGCGGCATGATGCGCCATGATGCGCCCGAACGCT
ACTATCATACCCGTGTAAAGCGCGGTGTATCCGGTCTGTATAACACCTGGCTTATTCTTGGCGGGCGCTC
TTTCGAGCTTGACCAGCTCTCTGAGAAACCTGAGTCGCTCTCCATGCGTATCACCGCAACCAACGGCCAG
CTACCGCGTAAGGCGCTGGAAAGCACCCTGCTGGACCGGGTGGTCAAGGCAGGCAAAGTACCGGTTAAGG
TGCTGAACGTCTCGGCACCAACGCTGCCGCTGTACCCGCCTGCAAACGATCGTTTCCACTGGCGGGTAAT
GAGCCACCTTGGATCGAATTTCCTTAGCATGATGGACAATCCGGAAGTGCTGCGCGGAACCCTGGCGCTG
TACGACTGGAGCAATGATGAGATTAACCGCCGGCGTCTGGAGGCGATCGTTGCGGTAAAACACACGCTCA
TTCGCCGCTTTGAGAAAGGCTTTATGCTGCGCGGCGTGGATATCGAGGTCACGCTGAATGCGGATAACTT
CGCGGGCGAGGGGGATGTGAATCTCTTCGGCGAGATGCTGCATCGCTTCTTCGGGCTGTATGCGGATATT
CACCTATTCAATCAGCTTACGCTGTTGCTGCAACCGACAGGGAAACGACTGCGATGGAACGAAATTCACA
GCCAGCACGTACCGGGCTGA